SecReT4
Protein ID: 114326570
T4SS name [ID]Trb [236]
Gene symbol-
Locus tagNeut_2548
StrainNitrosomonas eutropha C91
Repliconplasmid Plasmid1 [GenBank: NC_008341] [Browse all T4SS(s) in this replicon]
Location [Strand]20607..21059 [-]
Productmating pair formation protein TrbG
Component typeTrbG
UniProt IDQ0AD20
KEGG IDnet:Neut_2548
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.4e-19, Aligned region: 78..150
Protein Sequence: 150 a.a.     [Download]
>gi|114326570|ref|YP_743729.1| mating pair formation protein TrbG [Nitrosomonas eutropha C91]
MKKQQLIIGMAAFVLTIPAYAQTSQSQNEPLPIFAGQKPRLDSKEVYGAKLANQWKTNPDKPRRGEDGNV
KYLFGATLPTLVCTPLQVCSIRLQQGEIVNDVHAGDAVRWKITPATEGSGQTASTIIIIKPTDINLTTNL
IVTTDRRTYM
 
Nucleotide Sequence: 453 bp     [Download]
>gi|114326555|ref|NC_008341.1|:c21059-20607 Nitrosomonas eutropha C91 plasmid1, complete sequence
ATGAAAAAACAACAATTGATCATAGGCATGGCTGCTTTTGTATTAACTATTCCCGCATATGCACAAACAT
CTCAAAGCCAGAATGAGCCATTACCAATATTTGCAGGACAAAAACCACGACTGGATTCAAAGGAAGTGTA
CGGAGCAAAGCTTGCTAACCAATGGAAAACAAACCCTGACAAGCCGCGTCGCGGCGAGGATGGAAACGTT
AAATATCTTTTTGGTGCAACCCTTCCAACTCTTGTCTGCACCCCATTACAGGTATGCTCTATACGTTTGC
AGCAAGGTGAAATCGTCAATGATGTCCATGCTGGCGACGCAGTACGCTGGAAAATCACACCGGCTACCGA
AGGTTCAGGGCAGACAGCATCAACCATCATTATTATTAAACCCACAGATATTAACCTGACAACAAATCTG
ATTGTTACTACGGACAGACGCACCTATATGTAA
 Primer design