SecReT4
Protein ID: 114326572
T4SS name [ID]Trb [236]
Gene symbol-
Locus tagNeut_2550
StrainNitrosomonas eutropha C91
Repliconplasmid Plasmid1 [GenBank: NC_008341] [Browse all T4SS(s) in this replicon]
Location [Strand]21880..23334 [-]
ProducttrbL protein
Component typeTrbL
UniProt IDQ0AD18
KEGG IDnet:Neut_2550
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 6e-22, Aligned region: 55..266
Protein Sequence: 484 a.a.     [Download]
>gi|114326572|ref|YP_743731.1| trbL protein [Nitrosomonas eutropha C91]
MVATVFFIAPGTAIAADLHDATGSFKDLLGLIQNSASYWDGKLRDYAITLFWSLAVIQLIWTFLPLVFKQ
ADFGEIVGELVRFVLVTGFFFALLKFSTSWGQAIINSFREAGGNASGFGKTIFPGDMFGIAVELGDTILH
VHTLNPLTAVFVTLSGVIVVLCFGFIAAFMALTLIESYIVINASVLFMGFGGSQWTREYALAITRYAIAV
GAKLFILTLIVGLIMSSVNDWKASFHNDNADMLTMVGLGLACAYLSKTIPELVAGMITGSSPTGGHALGF
MAAAISAGVASGISAAATNGIFGKSGTGIGSNGSGSDGLADMISSSLMGGSSSTGSNMRENINAYGNSGD
SNSRSPMNNTLPPQRTGGGQTGKPTTLGTPPTGGQSQGDNKSPVSPLTQFADSAVKSTGIMAAISVPGME
PAMNLSLNVPPPDYGEDEDKNQDMAPNKNMGAGDSNIILAGETTVPSNTPPQQNQSDKQTKPDL
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|114326555|ref|NC_008341.1|:c23334-21880 Nitrosomonas eutropha C91 plasmid1, complete sequence
TTGGTTGCAACTGTCTTTTTTATTGCGCCAGGTACTGCGATTGCCGCTGATCTTCACGATGCAACCGGTT
CATTTAAAGACTTGCTGGGATTAATACAAAACAGCGCATCATACTGGGATGGAAAATTACGGGACTATGC
CATAACCCTTTTCTGGAGCTTAGCTGTCATTCAACTCATCTGGACGTTTTTACCGTTAGTTTTCAAACAG
GCAGATTTTGGAGAGATCGTCGGAGAATTAGTCAGGTTTGTTTTAGTAACTGGTTTTTTCTTTGCATTAC
TCAAATTTTCAACCAGTTGGGGACAAGCAATTATTAACAGTTTCCGTGAGGCTGGAGGTAATGCTTCAGG
TTTTGGAAAAACGATTTTTCCTGGCGATATGTTCGGAATAGCTGTTGAACTGGGCGATACCATATTGCAT
GTTCATACGTTAAATCCTTTGACAGCAGTGTTTGTAACGCTATCCGGAGTAATTGTAGTACTTTGTTTTG
GATTTATCGCTGCATTCATGGCGTTGACATTAATTGAATCATATATCGTTATTAATGCTTCTGTTTTATT
TATGGGATTTGGGGGGTCACAGTGGACGCGCGAGTACGCGTTAGCCATCACCAGATACGCCATCGCTGTA
GGAGCAAAGCTGTTTATTCTGACACTGATCGTCGGATTGATTATGAGTTCGGTTAATGACTGGAAAGCCA
GTTTCCACAATGACAATGCTGACATGCTGACGATGGTTGGATTAGGATTGGCGTGCGCCTACCTCTCAAA
AACCATTCCAGAACTGGTAGCAGGAATGATTACAGGATCTTCTCCGACTGGCGGTCACGCTCTTGGTTTC
ATGGCCGCTGCTATTTCGGCCGGTGTTGCATCAGGTATTTCGGCGGCAGCAACCAACGGCATATTTGGTA
AGTCAGGAACCGGGATTGGGAGCAACGGGTCAGGAAGTGATGGATTAGCAGATATGATTAGTTCCTCTCT
TATGGGAGGCAGTTCATCCACCGGTAGCAATATGCGTGAAAATATAAATGCTTATGGCAACTCGGGTGAT
AGCAATTCAAGATCTCCCATGAATAACACGCTGCCTCCACAGCGTACAGGAGGAGGACAAACTGGCAAAC
CAACGACATTGGGAACACCCCCTACAGGGGGTCAATCACAGGGTGATAACAAAAGTCCGGTTTCTCCTTT
AACGCAATTTGCTGATAGCGCGGTGAAATCTACCGGTATTATGGCTGCAATATCTGTCCCTGGTATGGAA
CCAGCCATGAATTTATCCCTGAACGTTCCACCTCCAGATTATGGGGAAGATGAAGATAAAAATCAGGATA
TGGCACCAAATAAGAACATGGGTGCCGGTGATTCCAACATCATACTGGCAGGCGAGACTACTGTCCCGAG
CAATACTCCTCCTCAACAAAATCAGTCAGATAAGCAGACAAAACCAGATTTGTAA
 Primer design