SecReT4
Protein ID: 114326576
T4SS name [ID]Trb [236]
Gene symbol-
Locus tagNeut_2554
StrainNitrosomonas eutropha C91
Repliconplasmid Plasmid1 [GenBank: NC_008341] [Browse all T4SS(s) in this replicon]
Location [Strand]27197..27652 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ0AD14
KEGG IDnet:Neut_2554
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.9e-18, Aligned region: 19..118
Protein Sequence: 151 a.a.     [Download]
>gi|114326576|ref|YP_743735.1| conjugal transfer protein TrbC [Nitrosomonas eutropha C91]
MNSATVATSPLFLYLHNLFKSPSFWLVVVIFALFFGVIDSAYAADATAGGGAGLPWEGPIQKISRSFSGP
VAFGVALLGIIACGATLIWGGEVSEFIRRIIYVVLVVCVIVFANTLLTGTLFSGAVVPADAHIMAADLTA
FGNPASAISEK
 
Nucleotide Sequence: 456 bp     [Download]
>gi|114326555|ref|NC_008341.1|:c27652-27197 Nitrosomonas eutropha C91 plasmid1, complete sequence
ATGAACTCAGCGACAGTAGCAACATCTCCACTATTTCTGTACCTCCATAATCTTTTTAAAAGCCCGTCGT
TCTGGTTGGTTGTGGTGATTTTTGCTCTTTTCTTTGGTGTTATTGATTCAGCGTATGCAGCTGATGCAAC
AGCAGGAGGTGGAGCTGGGTTACCGTGGGAAGGCCCAATACAGAAAATTTCTCGATCTTTTTCTGGCCCA
GTTGCTTTCGGGGTTGCTCTTTTAGGCATTATTGCCTGTGGAGCAACCCTTATATGGGGTGGAGAAGTAT
CAGAATTTATAAGGAGAATTATTTATGTTGTCCTGGTGGTTTGCGTCATCGTATTTGCCAACACATTACT
GACCGGTACGCTGTTCTCTGGCGCTGTTGTTCCAGCTGACGCGCATATCATGGCAGCAGACTTAACTGCC
TTTGGTAATCCAGCTTCAGCTATTTCAGAAAAATAA
 Primer design