SecReT4
Protein ID: 114326650
T4SS name [ID]VirB [204]
Gene symbol-
Locus tagNeut_2628
StrainNitrosomonas eutropha C91
Repliconplasmid Plasmid2 [GenBank: NC_008342] [Browse all T4SS(s) in this replicon]
Location [Strand]41733..43733 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDQ0ACU1
KEGG IDnet:Neut_2628
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.5e-99, Aligned region: 135..560
TraG-D_C [PF12696], Evalue: 1.1e-28, Aligned region: 400..524
TrwB_AAD_bind [PF10412], Evalue: 1.1e-26, Aligned region: 166..531
Protein Sequence: 666 a.a.     [Download]
>gi|114326650|ref|YP_743808.1| TRAG family protein [Nitrosomonas eutropha C91]
MPKKTSVFADMTPKKWIGVMIGLLSLGGLVYCAFWVSGMVLYASFHENPLKANIHTIFDATASIETHRQK
VKVIGSYFVGFFLCLAIPFGMIMAYRRHDPDVYGKGRFANRKDIDNEGLFAERGICLGRFAQDLMHLPGY
EFVLLAAPTRTGKGVGFVIPNLLTFRESTVVLDIKGENYNLTSAFRRKHLGNEIFYFNPFSETTHRWNPL
SYVSENPLFRVNDLRALAAIIFKTPERSDPFWSDSARNLFVAIALLVLETPRLPHTMGEILRQASGKGKD
TALYLREVIAVRQNTAKPLSRECKDAINRFLNGSDDTLKNILSTFTSALGVFSSPVTDKATSADDFDLRD
IRKRKMSIYIHISAGEVMQAQFITNLFFSQLINENVKELPEQNPALKYQCLLMMDEFTAARKIEILAKGV
GFMAGYNMRLALVIQNNSQLESTYGKEDAHSIMDNMGVKIFYTPSQVKEAEEYSKMLGNITAIAQSTQHS
NIGPLNVGRYSKSETDTLVSRALMLPQELMQLDKEKELVHRSGIPIIFGNKIRYYEDDYFMRRFTAVEMH
KVSIGGEVRKVPLPLPLPNTNWRLYRGQVQRSDYYVDSQLDDLAHPAETNSVSMLVDIVNMVEDDPNPQD
AALRDAACEDLALAKVNEFAALFDSLGTTDTGVLDR
 
Nucleotide Sequence: 2001 bp     [Download]
>gi|114326611|ref|NC_008342.1|:c43733-41733 Nitrosomonas eutropha C91 plasmid2, complete sequence
ATGCCTAAAAAAACCTCCGTATTTGCAGATATGACCCCAAAAAAATGGATCGGTGTGATGATTGGTCTGC
TGTCGCTCGGTGGGTTGGTTTATTGCGCATTTTGGGTGTCTGGAATGGTGCTGTATGCCTCTTTCCATGA
AAATCCTTTGAAGGCCAATATTCACACGATTTTCGATGCCACTGCGTCTATCGAAACGCACCGCCAGAAG
GTTAAGGTTATAGGTAGTTATTTTGTCGGCTTTTTTTTATGCCTGGCTATTCCATTTGGCATGATTATGG
CCTATCGACGGCATGACCCTGATGTGTACGGAAAGGGCCGCTTTGCCAATCGAAAAGATATTGATAATGA
GGGGCTATTTGCCGAAAGGGGCATTTGTTTAGGCCGTTTCGCCCAAGATTTGATGCATTTGCCTGGTTAT
GAATTTGTGCTGCTAGCCGCGCCTACTCGTACCGGCAAGGGTGTGGGGTTTGTTATTCCTAATTTGCTTA
CGTTTCGTGAATCCACCGTGGTGTTGGATATCAAGGGGGAAAACTACAACCTGACTTCTGCATTTCGCCG
AAAACACCTGGGCAACGAGATTTTTTATTTCAACCCGTTCTCGGAAACAACACACCGCTGGAATCCCCTG
TCATATGTTTCTGAAAATCCACTTTTTCGTGTCAATGATCTGCGGGCTTTAGCCGCAATCATTTTTAAGA
CACCTGAACGCAGCGATCCTTTTTGGTCTGACAGTGCGCGTAACCTTTTTGTTGCCATAGCACTGCTGGT
ACTCGAAACGCCACGCTTACCGCATACCATGGGCGAAATTCTGCGTCAGGCGTCGGGTAAAGGCAAAGAC
ACGGCCTTATATCTACGTGAAGTGATTGCGGTCAGGCAAAACACGGCAAAACCACTATCACGTGAGTGCA
AAGATGCAATTAATCGGTTCTTGAATGGCTCTGACGACACATTAAAAAATATCCTGTCTACGTTCACATC
TGCTCTGGGTGTGTTCAGCAGCCCGGTCACGGACAAAGCCACCAGTGCAGACGACTTTGATTTGCGTGAT
ATACGCAAACGTAAAATGTCAATTTATATTCACATTTCTGCCGGGGAAGTGATGCAGGCACAATTCATTA
CCAACCTGTTTTTCTCGCAGTTGATCAATGAAAACGTCAAAGAATTGCCCGAGCAAAACCCGGCCTTAAA
GTATCAATGCTTGCTTATGATGGATGAATTTACCGCTGCCAGAAAAATTGAAATTCTCGCCAAGGGTGTC
GGCTTTATGGCCGGGTACAACATGCGCCTAGCACTGGTTATTCAAAACAATTCACAGCTTGAATCAACCT
ACGGCAAAGAAGATGCCCACTCGATTATGGATAACATGGGCGTCAAGATTTTTTATACACCATCTCAAGT
AAAAGAGGCGGAAGAATATTCTAAGATGCTAGGGAACATTACGGCGATCGCGCAATCAACGCAGCATTCC
AACATTGGGCCATTGAATGTTGGCCGTTACAGCAAGTCAGAAACCGATACGCTGGTTTCTCGTGCCTTGA
TGTTGCCACAAGAATTGATGCAGCTCGACAAGGAAAAGGAATTGGTGCATCGCTCTGGCATTCCTATCAT
CTTCGGCAACAAGATCCGATATTACGAAGATGATTATTTCATGCGTCGGTTCACGGCAGTTGAAATGCAC
AAGGTTTCTATTGGCGGTGAAGTGCGCAAGGTGCCTTTGCCGCTGCCATTGCCAAATACAAATTGGCGTC
TCTATCGCGGCCAGGTTCAGCGCAGTGATTACTATGTGGATTCGCAATTGGACGATTTGGCGCATCCCGC
AGAAACAAATAGCGTTTCAATGCTGGTGGATATAGTAAACATGGTTGAGGATGACCCAAATCCCCAGGAT
GCAGCGCTGCGTGATGCAGCCTGTGAGGATTTAGCCCTCGCCAAAGTTAATGAATTTGCCGCGCTGTTTG
ACAGCCTCGGAACTACTGATACAGGTGTGCTTGACCGCTAA
 Primer design