SecReT4
Protein ID: 114326651
T4SS name [ID]VirB [204]
Gene symbol-
Locus tagNeut_2629
StrainNitrosomonas eutropha C91
Repliconplasmid Plasmid2 [GenBank: NC_008342] [Browse all T4SS(s) in this replicon]
Location [Strand]43726..44844 [-]
Producttype II secretion system protein E
Component typeVirB11
UniProt IDQ0ACU0
KEGG IDnet:Neut_2629
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 8.2e-61, Aligned region: 38..342
Protein Sequence: 372 a.a.     [Download]
>gi|114326651|ref|YP_743809.1| type II secretion system protein E [Nitrosomonas eutropha C91]
MNSTVLKSLETNLGTAGLFPDSEYVPLQDDAAIQAYLAPYKQWREDPRVTEIAVNDDGRVWVYTNQWDSY
NVPQINQHSLLSLGGAIATYTNSAQGWNAAYPILSGSLKDNSRVQLVMEPGVLRGHVSFTLRQPSRARIS
LKEMEEQGMFQGTTQSTFTIKPHEKELLALVKSRKIIEFLTKAVQYRQNIVLSGATGSGKTTVMKALVDV
IDPGERIITIEDAHELSLTQPNVVHLLYDNAKTRPGSDTPVLSAKDALLSCLRMKPDRILLAEMRGSECL
YFLRAALSGHPGTLTSCHGENPAMAYEQMMMMVKSDPVGAGLDYNVIKRLIHLTVDIVVQIEVDRHTGQR
RVVEIDYNPQRKYAIAQGKDHA
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|114326611|ref|NC_008342.1|:c44844-43726 Nitrosomonas eutropha C91 plasmid2, complete sequence
ATGAACTCAACAGTTTTGAAATCTTTGGAAACCAATCTTGGCACTGCGGGCCTGTTTCCAGATTCAGAAT
ATGTTCCGTTGCAAGATGACGCCGCAATACAGGCGTATCTTGCCCCATACAAGCAATGGCGCGAAGATCC
CCGTGTAACAGAAATCGCCGTCAATGATGATGGCAGGGTTTGGGTGTACACAAACCAATGGGATAGCTAC
AACGTGCCGCAGATCAATCAGCACAGCTTGTTGTCGCTCGGGGGCGCTATTGCGACCTATACCAATTCGG
CACAAGGTTGGAATGCCGCCTATCCGATCTTATCCGGTTCTTTAAAAGACAATTCTCGGGTACAACTTGT
GATGGAGCCTGGCGTACTGCGCGGGCATGTCTCGTTTACGCTTCGCCAACCATCAAGAGCGCGTATTTCC
TTAAAGGAAATGGAAGAACAGGGTATGTTTCAGGGCACTACCCAATCCACATTCACTATTAAACCGCATG
AAAAAGAACTGCTGGCCTTGGTGAAGTCGCGCAAGATCATTGAGTTTCTAACAAAGGCGGTTCAGTACCG
CCAGAATATTGTTTTGTCCGGGGCTACTGGCTCCGGAAAAACAACCGTGATGAAAGCCCTAGTCGATGTA
ATCGACCCTGGCGAACGCATCATTACTATCGAAGATGCTCACGAATTGAGCCTCACACAACCTAACGTAG
TGCATTTGCTCTATGACAACGCCAAAACGCGGCCGGGCTCTGACACACCGGTTTTGTCGGCTAAAGATGC
ACTGCTTAGTTGTCTTCGGATGAAGCCAGACAGAATCCTGCTGGCCGAGATGCGCGGCTCAGAGTGTTTG
TATTTTCTTCGCGCTGCATTAAGCGGGCATCCCGGCACACTCACGAGCTGCCACGGCGAAAATCCCGCGA
TGGCTTACGAGCAGATGATGATGATGGTGAAATCCGATCCTGTGGGTGCTGGGCTAGATTACAACGTCAT
CAAGCGCCTGATTCATTTAACGGTCGATATCGTGGTGCAAATCGAAGTTGATAGGCACACAGGCCAGCGA
CGTGTTGTAGAAATCGACTATAACCCGCAGCGCAAATATGCCATTGCCCAAGGGAAAGATCATGCCTAA
 Primer design