SecReT4
Protein ID: 114326654
T4SS name [ID]VirB [204]
Gene symbol-
Locus tagNeut_2632
StrainNitrosomonas eutropha C91
Repliconplasmid Plasmid2 [GenBank: NC_008342] [Browse all T4SS(s) in this replicon]
Location [Strand]46727..47437 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDQ0ACT7
KEGG IDnet:Neut_2632
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 8.3e-47, Aligned region: 21..230
Protein Sequence: 236 a.a.     [Download]
>gi|114326654|ref|YP_743812.1| VirB8 family protein [Nitrosomonas eutropha C91]
MNKENTKKPGDITPNDDLRDVTWEAELNAILRNSLKRHAALNYVLAVAVAALTIALAVLMPLKQLVPYVV
RVDNLTGATSIGQTVQDYVAESELADKHWVNKFVVARERYNYHLIQDDYDTVKSLAGDTPWKQYNELFSG
PQALDRQFGKNILFTPKIISISLTETGGQKFATVRLSVQQRDLRTESKLRAVHKVATLRYEYEPRLFISE
QAAIDNPFGFTVLGYQTDNEFIGGEQ
 
Nucleotide Sequence: 711 bp     [Download]
>gi|114326611|ref|NC_008342.1|:c47437-46727 Nitrosomonas eutropha C91 plasmid2, complete sequence
ATGAACAAGGAAAACACGAAAAAACCCGGCGATATCACCCCGAACGACGACTTGCGCGACGTTACTTGGG
AAGCAGAATTAAACGCCATTTTGCGTAATTCTCTGAAACGCCATGCAGCGCTTAATTATGTACTCGCGGT
CGCGGTTGCTGCTCTGACAATAGCCCTGGCTGTACTCATGCCACTTAAACAGTTAGTGCCCTATGTTGTG
CGCGTTGACAATTTGACCGGGGCAACTTCTATCGGTCAAACCGTACAGGACTACGTAGCGGAATCTGAAT
TAGCCGATAAACACTGGGTGAATAAGTTTGTTGTTGCGCGTGAACGCTATAACTACCACTTAATACAAGA
TGACTATGACACCGTTAAGAGTCTTGCTGGTGATACGCCGTGGAAACAATACAACGAACTTTTTAGCGGC
CCCCAAGCCCTTGATCGGCAATTCGGCAAGAATATCCTGTTCACCCCTAAAATCATCAGCATCTCGCTGA
CGGAAACGGGCGGTCAGAAATTTGCCACGGTACGTCTGTCGGTTCAGCAACGTGACCTACGTACAGAATC
CAAGTTACGTGCAGTCCATAAAGTTGCCACGCTTCGCTATGAATATGAACCACGTTTGTTCATTAGTGAA
CAGGCTGCGATTGATAACCCGTTTGGTTTCACTGTCTTGGGCTATCAAACCGACAACGAATTCATAGGGG
GTGAACAATGA
 Primer design