SecReT4
Protein ID: 114330106
T4SS name [ID]Tfc [706]
Gene symbol-
Locus tagNeut_0075
StrainNitrosomonas eutropha C91
Repliconchromosome [GenBank: NC_008344] [Browse all T4SS(s) in this replicon]
Location [Strand]74346..75743 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDQ0AJV8
KEGG IDnet:Neut_0075
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 465 a.a.     [Download]
>gi|114330106|ref|YP_746328.1| hypothetical protein Neut_0075 [Nitrosomonas eutropha C91]
MIRPDMTKPVSLIPRSCRPAVLACALALACGLASAQSGGFQNSGSVIGDEVMYSIGGGNAVSMSGAAGMR
SIGVGAGWNSNLICGDMSISTTIQNQLNGLTNGFQNIMSSVIQNATSAVASLPALIIQRADPGLYNLLTN
GVLQARLDFDRSKLQCRAMAEKMADMAGGQMGWNQLAEGMALRDAVASSDAVSAIEQAETSRGNDGVPWV
GGGNAGGTGQSPIKVVGDVTRAGYNLVNGRSVSDTSTIAQASCGSLSCQTWSSPDAAVQWATRVLGEQEQ
RTCESCTKTQTIPGVGLTPLIQEEYDAKLQALQELITGARNTTFENLHEAGSASLPITRGVIEALRDEPD
QDILARRLASEVALASVLEKALLLQRTLLTGRKEPNVAANQIAVDAVNQESDTLDREIQNLKTELELRRE
LANNSPMAIIQRHSTRAAGSRGIYQGDPVPDRLQQLQRPTPDGTP
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|114330036|ref|NC_008344.1|:c75743-74346 Nitrosomonas eutropha C91 chromosome, complete genome
ATGATCCGTCCTGATATGACAAAACCCGTAAGCCTGATTCCGCGCTCGTGCCGCCCAGCGGTGCTGGCCT
GTGCACTGGCTTTGGCCTGCGGTTTGGCCTCGGCGCAAAGCGGGGGATTCCAGAATAGCGGCAGCGTCAT
CGGTGACGAGGTCATGTATTCCATTGGTGGCGGGAACGCCGTCTCGATGAGCGGTGCGGCAGGGATGCGC
TCAATCGGTGTGGGCGCCGGTTGGAACAGCAATCTGATCTGTGGCGACATGAGCATCAGCACCACGATCC
AGAATCAGCTCAACGGCCTGACCAACGGTTTTCAGAACATCATGAGCAGCGTTATCCAGAATGCGACCAG
CGCGGTGGCATCGCTTCCGGCGCTGATCATCCAGCGTGCCGATCCGGGACTGTACAACCTGCTGACCAAT
GGTGTGCTGCAGGCCCGGCTGGACTTTGACCGATCCAAGCTTCAGTGTCGCGCCATGGCCGAAAAAATGG
CCGACATGGCGGGGGGGCAGATGGGCTGGAACCAGCTTGCCGAAGGCATGGCGCTGCGCGATGCGGTTGC
CAGCAGCGATGCGGTCTCGGCGATCGAACAGGCCGAAACCAGCCGGGGTAACGACGGCGTGCCGTGGGTG
GGAGGGGGCAACGCCGGGGGCACGGGCCAATCCCCGATCAAGGTGGTGGGGGATGTGACACGCGCCGGGT
ACAACTTGGTCAATGGCCGTAGCGTGTCTGACACGTCCACTATCGCCCAGGCCAGTTGCGGCAGTCTTTC
CTGCCAGACCTGGTCGTCACCGGACGCGGCAGTTCAGTGGGCGACCCGTGTGCTGGGTGAACAAGAGCAG
CGCACGTGCGAATCCTGCACCAAGACCCAGACCATCCCGGGCGTGGGTCTGACGCCGCTGATCCAGGAGG
AGTACGACGCCAAGCTCCAAGCACTGCAAGAGCTGATTACGGGCGCTCGCAACACCACGTTTGAGAACCT
GCATGAAGCAGGCAGTGCCTCGCTGCCGATCACCCGAGGGGTGATCGAGGCCCTGCGCGACGAGCCCGAC
CAGGACATTCTGGCCCGCCGTCTGGCGTCCGAAGTCGCGCTGGCTTCCGTGCTGGAAAAAGCGCTGCTGC
TGCAACGCACCTTGTTGACCGGCAGGAAGGAACCCAACGTCGCGGCCAACCAAATAGCGGTGGATGCGGT
GAACCAGGAAAGCGACACGCTGGATCGGGAAATTCAGAATCTCAAGACTGAACTGGAGCTGCGTCGTGAG
CTCGCCAACAATTCGCCCATGGCAATCATCCAGCGCCACAGCACACGGGCGGCTGGGTCGCGTGGTATCT
ACCAGGGCGACCCAGTGCCCGACCGCCTGCAACAATTGCAGCGGCCCACACCGGATGGCACACCATGA
 Primer design