SecReT4
Protein ID: 114330122
T4SS name [ID]Tfc [706]
Gene symbol-
Locus tagNeut_0091
StrainNitrosomonas eutropha C91
Repliconchromosome [GenBank: NC_008344] [Browse all T4SS(s) in this replicon]
Location [Strand]90808..91206 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDQ0AJU2
KEGG IDnet:Neut_0091
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 7.6e-47, Aligned region: 10..130
Protein Sequence: 132 a.a.     [Download]
>gi|114330122|ref|YP_746344.1| hypothetical protein Neut_0091 [Nitrosomonas eutropha C91]
MSEHQHIRSDGTVSFLPHRLNRHPVVVRGLTADELWMCCGLSGAVGLLTGAPLSWLFSTIALAPTFIVVG
IALGVFVGGGILRRKKRGRPDTWLYRQLQWRIAISYPLLAGWVRGHALVTRTGYWTVRRGVQ
 
Nucleotide Sequence: 399 bp     [Download]
>gi|114330036|ref|NC_008344.1|:c91206-90808 Nitrosomonas eutropha C91 chromosome, complete genome
ATGTCCGAGCACCAGCACATCCGGTCCGATGGCACCGTGTCGTTTCTGCCGCATCGTCTTAATCGCCATC
CGGTCGTGGTACGCGGTTTGACGGCGGACGAGCTGTGGATGTGCTGCGGGCTGTCGGGCGCGGTGGGATT
ATTGACGGGTGCGCCGTTGTCCTGGCTTTTCTCGACCATTGCCCTGGCACCGACCTTCATTGTCGTCGGC
ATTGCCTTGGGCGTGTTCGTCGGTGGTGGAATTCTGCGCCGCAAGAAGCGCGGCAGGCCCGACACGTGGC
TGTATCGGCAATTGCAATGGCGCATCGCGATCTCATACCCGTTGCTGGCAGGCTGGGTGCGCGGCCATGC
GTTGGTCACGCGCACCGGCTATTGGACAGTCCGAAGGGGCGTGCAATGA
 Primer design