SecReT4
Protein ID: 114330125
T4SS name [ID]Tfc [706]
Gene symbol-
Locus tagNeut_0094
StrainNitrosomonas eutropha C91
Repliconchromosome [GenBank: NC_008344] [Browse all T4SS(s) in this replicon]
Location [Strand]91822..92193 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDQ0AJT9
KEGG IDnet:Neut_0094
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 3.7e-30, Aligned region: 28..107
Protein Sequence: 123 a.a.     [Download]
>gi|114330125|ref|YP_746347.1| hypothetical protein Neut_0094 [Nitrosomonas eutropha C91]
MVLSIRCRAVHGGVSLLLTAVLAVPLAAHADVPAQRQDLAAVLRQLDALERFVAHSAAATPIVPGDRYHF
DYPRLLADLARVRTGIQSHLTPSRAQPRDLTELAGDYRSERAPQHNPLPQAQP
 
Nucleotide Sequence: 372 bp     [Download]
>gi|114330036|ref|NC_008344.1|:c92193-91822 Nitrosomonas eutropha C91 chromosome, complete genome
ATGGTGCTCTCGATTCGGTGTCGCGCCGTGCACGGCGGCGTGTCTCTCCTGCTCACAGCGGTCTTGGCCG
TGCCGCTTGCGGCTCACGCCGATGTGCCAGCTCAGCGGCAAGACCTGGCTGCGGTCTTGCGCCAACTTGA
TGCGTTGGAACGATTCGTGGCACACAGTGCAGCGGCCACGCCCATCGTGCCGGGTGATCGTTACCACTTC
GACTATCCGCGCTTGCTGGCCGACCTGGCCCGTGTGCGTACCGGCATTCAGTCTCATCTCACCCCATCGC
GCGCTCAACCGCGGGATCTTACCGAGTTGGCGGGGGATTACCGTAGTGAGCGTGCGCCCCAGCACAACCC
GTTGCCGCAGGCCCAGCCATGA
 Primer design