SecReT4
Protein ID: 114330128
T4SS name [ID]Tfc [706]
Gene symbol-
Locus tagNeut_0097
StrainNitrosomonas eutropha C91
Repliconchromosome [GenBank: NC_008344] [Browse all T4SS(s) in this replicon]
Location [Strand]93530..94279 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDQ0AJT6
KEGG IDnet:Neut_0097
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 3.6e-68, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|114330128|ref|YP_746350.1| hypothetical protein Neut_0097 [Nitrosomonas eutropha C91]
MSDAASTAQQQQKRRQGVLASIIGLPLQLFGVLIGSLLISILVECVGMHLFWKEQGWRHSQSMLQYELSH
LSSHFRRSVIVREPGRTAHQLVDTGHEWIFVKTGVGDRMSHTADRARVPSQSGTKNFRYYLSQAYVWSER
YLIAAAFTTLTFLVRLLILVLTLPLILLAAFVGLVDGLVRRDVRKFGAGRESGFFYHRAKASLMPLAVLP
WVVYLALPISLHPLLILLPSAALLGLAVNLTAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|114330036|ref|NC_008344.1|:c94279-93530 Nitrosomonas eutropha C91 chromosome, complete genome
ATGAGCGATGCAGCATCCACGGCACAACAACAGCAAAAGCGCCGTCAGGGGGTGTTAGCCAGCATCATAG
GCTTACCGCTTCAGCTCTTCGGCGTGTTAATCGGGTCACTGCTAATTTCCATCCTGGTCGAGTGTGTGGG
TATGCACCTGTTCTGGAAGGAGCAGGGTTGGCGCCACTCGCAGTCGATGCTGCAGTATGAGTTGAGCCAC
TTATCAAGCCACTTCAGACGTAGCGTCATCGTGCGCGAGCCTGGGCGTACCGCACACCAGTTGGTGGACA
CCGGCCATGAATGGATTTTTGTGAAAACCGGCGTGGGTGACCGGATGAGCCACACTGCCGATCGTGCCCG
CGTTCCGAGTCAAAGCGGTACCAAGAACTTTCGCTATTACCTGAGCCAGGCTTACGTCTGGTCGGAGCGT
TACCTGATTGCCGCGGCCTTCACCACGCTCACTTTCTTGGTGCGATTACTGATCTTGGTGCTAACCTTGC
CGTTGATCCTGCTGGCGGCGTTCGTTGGTCTGGTCGATGGATTGGTACGCCGTGACGTGCGAAAGTTCGG
CGCGGGTCGTGAATCGGGGTTCTTTTACCACCGCGCTAAAGCGTCGCTGATGCCGCTGGCCGTACTGCCC
TGGGTGGTCTATCTGGCGTTGCCTATATCTCTACACCCTCTATTAATCCTACTGCCCAGCGCCGCGCTAC
TGGGGCTGGCGGTGAACCTGACAGCGGGGAGCTTTAAGAAGTATTTATAG
 Primer design