SecReT4
Protein ID: 114330131
T4SS name [ID]Tfc [706]
Gene symbol-
Locus tagNeut_0100
StrainNitrosomonas eutropha C91
Repliconchromosome [GenBank: NC_008344] [Browse all T4SS(s) in this replicon]
Location [Strand]96994..97584 [-]
Productlytic transglycosylase, catalytic
Component typeTfc4
UniProt IDQ0AJT3
KEGG IDnet:Neut_0100
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 196 a.a.     [Download]
>gi|114330131|ref|YP_746353.1| lytic transglycosylase, catalytic [Nitrosomonas eutropha C91]
MAATTLSPVQPLWVLLLAAGLLTSHGYAQEVPPPAYQLAAQRVGIPSTVLFAVALQESGIRRDNRIIPWP
WSLNVAGQSYRYATRAEACTALLQTLREAAPTRVDVGLAQINLGYQKHRYNRPCDLLDPYANLAIAAAIL
LEQYKPGEDWLLAMGRYHRPAGGEPAARYRRSVSRHLNRVQGSPGASRASYLESSQ
 
Nucleotide Sequence: 591 bp     [Download]
>gi|114330036|ref|NC_008344.1|:c97584-96994 Nitrosomonas eutropha C91 chromosome, complete genome
ATGGCAGCGACAACCCTAAGCCCGGTGCAGCCCCTGTGGGTGCTGCTGTTGGCGGCTGGTCTGCTCACCA
GTCACGGGTATGCTCAGGAAGTCCCCCCTCCCGCCTATCAGTTGGCAGCTCAGCGAGTAGGCATCCCATC
GACGGTGCTCTTTGCCGTGGCCCTGCAAGAAAGCGGCATCCGCCGCGACAACCGCATCATCCCTTGGCCT
TGGTCGCTGAATGTAGCGGGTCAGTCGTACCGTTATGCCACGCGCGCCGAGGCTTGCACCGCTCTGCTCC
AGACGCTGAGGGAGGCTGCGCCCACCCGCGTTGATGTGGGCCTCGCGCAAATCAACCTGGGCTATCAGAA
ACACCGCTACAACCGCCCGTGTGACCTGCTCGACCCCTACGCCAACTTGGCAATTGCCGCCGCCATTCTG
CTTGAGCAGTACAAGCCGGGTGAGGATTGGCTGTTGGCAATGGGTCGTTACCACCGTCCAGCAGGCGGAG
AGCCGGCGGCGCGTTATCGGCGCAGCGTTTCCCGGCACCTGAACCGTGTGCAGGGTTCGCCCGGCGCGTC
ACGCGCCAGCTATCTGGAGAGTTCACAATGA
 Primer design