SecReT4
Protein ID: 114881118
T4SS name [ID]Trb [75]
Gene symboltrbC
Locus tagpBS228_p024
StrainPseudomonas aeruginosa plasmid pBS228 (NC_008357)
Repliconplasmid pBS228 [GenBank: NC_008357] [Browse all T4SS(s) in this replicon]
Location [Strand]19799..20236 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ0E6E9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.5e-19, Aligned region: 16..110
Protein Sequence: 145 a.a.     [Download]
>gi|114881118|ref|YP_758659.1| conjugal transfer protein TrbC [Pseudomonas aeruginosa]
MTTAVPFRLTMNRGILFYLAVFFVLALALSAHPAMASEGTGGSLPYESWLTNLRNSVTGPVAFALSIIGI
VVAGGVLIFGGELNAFFRTLIFLVLVMALLVGAQNVMSTFFGRGAEIAALGNGALHQVQVAAADAVRAVA
AGRLA
 
Nucleotide Sequence: 438 bp     [Download]
>gi|114881096|ref|NC_008357.1|:19799-20236 Pseudomonas aeruginosa plasmid pBS228, complete sequence
ATGACAACGGCTGTTCCGTTCCGTCTGACCATGAATCGCGGCATTTTGTTCTACCTTGCCGTGTTCTTCG
TTCTCGCTCTCGCGTTATCCGCGCATCCGGCGATGGCCTCGGAAGGCACCGGCGGCAGCTTGCCATATGA
GAGCTGGCTGACGAACCTGCGCAACTCCGTAACCGGCCCGGTGGCCTTCGCGCTGTCCATCATCGGCATC
GTCGTCGCCGGCGGCGTGCTGATCTTCGGCGGCGAACTCAACGCCTTCTTCCGAACCCTGATCTTCCTGG
TTCTGGTGATGGCGCTGCTGGTCGGCGCGCAGAACGTGATGAGCACCTTCTTCGGTCGTGGTGCCGAAAT
CGCGGCCCTCGGCAACGGGGCGCTGCACCAGGTGCAAGTCGCGGCGGCGGATGCCGTGCGTGCGGTAGCG
GCTGGACGGCTCGCCTAA
 Primer design