SecReT4
Protein ID: 114881127
T4SS name [ID]Trb [75]
Gene symboltrbG
Locus tagpBS228_p034
StrainPseudomonas aeruginosa plasmid pBS228 (NC_008357)
Repliconplasmid pBS228 [GenBank: NC_008357] [Browse all T4SS(s) in this replicon]
Location [Strand]31673..32566 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ0E6E0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.3e-64, Aligned region: 72..295
Protein Sequence: 297 a.a.     [Download]
>gi|114881127|ref|YP_758668.1| conjugal transfer protein TrbG [Pseudomonas aeruginosa]
MKKELFALVLAASVSVPAFAADPGADLTDLYFSGKNPELTAQERAAIAIAKKWEAGTAGMRPVAGPGGSV
RFLFGAQQPSIVCAVLQVCDVALQPGEQVNSINLGDTARWTVEPAITGSGANETQHLIIKPMDVGLETSL
VVTTDRRSYHMRLRSHRTQYMPQVSFTYPEDALAKWDAIKNREQRDRVEKTIPQTGEYLGNLSFNYSVSG
STSWKPVRVYNDGKKTIIQMPHSMEQTEAPTLLVVRREGGLFSDDETVMVNYRVQGDRYIVDTIFDKAIL
IAGVGSSQDRVTISRGN
 
Nucleotide Sequence: 894 bp     [Download]
>gi|114881096|ref|NC_008357.1|:31673-32566 Pseudomonas aeruginosa plasmid pBS228, complete sequence
ATGAAAAAGGAACTGTTTGCTTTGGTCCTGGCCGCGTCCGTTAGCGTGCCTGCATTTGCCGCCGATCCCG
GCGCGGACCTGACTGACCTCTATTTTTCCGGCAAGAACCCGGAGCTGACCGCGCAAGAGCGGGCGGCCAT
CGCCATCGCCAAGAAGTGGGAGGCGGGTACCGCCGGCATGCGGCCGGTGGCCGGCCCCGGTGGTTCGGTG
CGCTTCCTGTTCGGCGCGCAGCAGCCGAGCATCGTATGCGCCGTGCTGCAAGTGTGCGACGTGGCCCTGC
AACCCGGCGAGCAAGTCAACTCGATCAACCTGGGCGACACCGCCCGTTGGACGGTCGAGCCGGCCATTAC
CGGCAGCGGCGCGAACGAAACCCAGCACCTCATCATCAAGCCGATGGATGTGGGCCTGGAAACCAGCCTG
GTCGTGACCACGGACCGCCGCAGCTACCACATGCGCCTGCGCTCGCATCGCACGCAGTACATGCCGCAGG
TGTCGTTCACCTACCCGGAAGATGCCCTTGCGAAGTGGGACGCCATCAAGAACCGCGAACAGCGGGATCG
CGTCGAGAAAACCATTCCGCAGACCGGCGAGTACCTGGGCAACCTGAGCTTCAACTACTCCGTCAGCGGG
TCCACGTCGTGGAAGCCGGTGCGCGTCTACAACGACGGCAAGAAAACCATCATCCAGATGCCGCACTCGA
TGGAACAGACCGAAGCGCCGACGCTCCTGGTCGTTCGCAGGGAGGGCGGCCTGTTCTCCGACGATGAAAC
GGTGATGGTCAACTACCGGGTCCAGGGCGACCGCTACATCGTCGATACGATTTTCGACAAGGCCATCCTC
ATCGCGGGCGTGGGCAGCAGCCAGGACCGCGTGACCATTTCAAGGGGGAACTAA
 Primer design