SecReT4
Protein ID: 114881132
T4SS name [ID]Trb [75]
Gene symboltrbL
Locus tagpBS228_p039
StrainPseudomonas aeruginosa plasmid pBS228 (NC_008357)
Repliconplasmid pBS228 [GenBank: NC_008357] [Browse all T4SS(s) in this replicon]
Location [Strand]35469..37055 [+]
ProductTrbL protein
Component typeTrbL
UniProt IDQ0E6D5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.2e-36, Aligned region: 63..276
Protein Sequence: 528 a.a.     [Download]
>gi|114881132|ref|YP_758673.1| TrbL protein [Pseudomonas aeruginosa]
MKIQTRAAALAVLMLALMPVAAYAQIDNSGILDNVLQRYQNAASGWATVVQNAATWLFWTLTVISMVWTF
GMMALRKADIGEFFAEFVRFTIFTGFFWWLLTNGPNFASSIYASLRQIAGQATGLGQGLSPSGIVDVGFE
IFFKVMDETSYWSPVDSFVGASLAAAILCILALVGVNMLLLLASGWILAYGGVFFLGFGGSRWTSDMAIN
YYKTVLGVAAQLFAMVLLVGIGKTFLDDYYSRMSEGINFKELGVMLIVGLILLVLVNKVPQLIAGIITGA
SVGGAGIGQFGAGTLVGAAATAGAAIATGGASIAAGAAAAAGGAQAIMAAASKASDNVSAGTDILSSMMG
GGGGGGGGSAGTSGGDGGGSGGGGGSGGGETPMASAAGDNSSGARGGSSGGGSGGGRSSGGIGATAAKGG
RIAADTVANLAKGAGSIAKAKAGEMRASAQERIGDTVGGKIAQAIRGAGAAAQTAATVADSNSQAQEQPA
PAPAPSFDDNSLSASNNREAAADADSEVASFVNKPAQS
 
Nucleotide Sequence: 1587 bp     [Download]
>gi|114881096|ref|NC_008357.1|:35469-37055 Pseudomonas aeruginosa plasmid pBS228, complete sequence
ATGAAAATCCAGACTAGAGCTGCCGCGCTCGCGGTCCTGATGCTGGCCTTGATGCCGGTAGCGGCATACG
CCCAAATCGACAATTCGGGCATCCTCGACAACGTATTGCAGCGCTACCAGAACGCCGCGAGCGGCTGGGC
CACTGTCGTCCAGAACGCCGCAACCTGGCTGTTCTGGACCTTGACCGTGATTAGCATGGTCTGGACCTTC
GGCATGATGGCACTGCGCAAGGCCGACATTGGCGAGTTCTTCGCCGAGTTCGTGCGGTTCACCATCTTCA
CCGGCTTCTTCTGGTGGCTGCTGACCAACGGCCCGAATTTCGCGTCGTCCATCTATGCGTCCCTGCGGCA
GATTGCAGGCCAGGCAACGGGGTTGGGGCAGGGGCTTTCGCCGTCCGGCATCGTCGATGTTGGCTTCGAG
ATTTTCTTCAAGGTGATGGACGAAACCTCGTACTGGTCGCCGGTCGATAGCTTCGTCGGTGCCTCGTTGG
CGGCCGCCATCCTCTGCATCCTGGCCCTGGTCGGCGTGAATATGCTTCTGCTCCTGGCGTCCGGATGGAT
TCTTGCCTACGGCGGTGTGTTCTTCCTGGGCTTCGGCGGCTCGCGCTGGACCTCGGACATGGCGATCAAC
TACTACAAGACCGTCCTCGGGGTCGCCGCGCAGCTCTTCGCAATGGTGCTGCTCGTAGGCATCGGCAAGA
CCTTCCTCGATGACTACTACAGCCGCATGAGCGAAGGCATCAACTTCAAGGAACTTGGAGTGATGCTGAT
CGTCGGCCTGATCCTGCTCGTTCTGGTCAACAAGGTGCCGCAGCTCATCGCCGGCATCATCACCGGCGCG
AGCGTCGGCGGTGCTGGTATCGGCCAGTTCGGCGCTGGCACGCTCGTCGGTGCGGCCGCGACGGCCGGCG
CGGCAATCGCAACTGGCGGCGCATCTATCGCGGCCGGCGCTGCGGCGGCGGCCGGTGGCGCGCAGGCCAT
CATGGCGGCCGCGTCGAAGGCCAGCGATAACGTCTCTGCCGGCACTGACATTCTGTCGAGCATGATGGGC
GGCGGCGGTGGCGGCGGCGGTGGTAGCGCCGGCACCAGCGGCGGCGACGGCGGCGGCTCGGGTGGCGGCG
GTGGCTCGGGCGGCGGTGAAACCCCGATGGCCTCGGCCGCCGGCGACAACAGCAGCGGCGCACGCGGCGG
CAGTTCGGGCGGCGGCTCGGGTGGTGGCCGTTCGTCTGGCGGTATCGGTGCCACGGCGGCCAAGGGCGGC
CGGATCGCGGCCGATACCGTCGCCAACCTGGCGAAAGGTGCCGGCTCGATTGCCAAGGCCAAGGCCGGCG
AAATGCGCGCATCGGCCCAGGAACGCATCGGCGATACCGTAGGCGGCAAGATCGCGCAGGCAATTCGCGG
CGCGGGTGCGGCGGCGCAGACCGCTGCAACCGTCGCCGATAGCAACAGCCAGGCGCAGGAACAACCTGCA
CCGGCACCCGCACCGTCGTTCGACGACAACAGCCTTTCCGCAAGCAACAACAGGGAAGCGGCCGCCGACG
CGGATTCCGAAGTGGCGAGCTTCGTCAACAAGCCCGCCCAATCCTGA
 Primer design