SecReT4
Protein ID: 114883645
T4SS name [ID]VirB [30]
Gene symbolvirD4
Locus tagD763_p2035
StrainPlasmid pLB1
Repliconplasmid pLB1 [GenBank: NC_008330] [Browse all T4SS(s) in this replicon]
Location [Strand]52724..54640 [-]
ProductVirD4 type IV secration protein
Component typeVirD4
UniProt IDQ0KKK9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 8.5e-107, Aligned region: 96..539
TrwB_AAD_bind [PF10412], Evalue: 1.7e-28, Aligned region: 133..518
TraG-D_C [PF12696], Evalue: 4.7e-28, Aligned region: 386..506
Protein Sequence: 638 a.a.     [Download]
>gi|114883645|ref|YP_740335.1| VirD4 type IV secration protein [uncultured bacterium]
MIQKTGSNRLALALVLLPITLLLIGLLTGTVAWFFLKMPAAAYDPLKLPGFFWYYRHDPVVTEALWRGAV
IGVPLPVLLMAIVLRPKKNLHGEARFAREGEIRKAGLRAKKGIVLGRVRNGFFRNGFLMVGKMEHVLLEA
PTGSGKGVGIVIPNLLQWPDSVVVLDIKRENYEITAGFRRKGGQKVVLFNPTDREGRTARYNPLSYINRA
DPIEVLVELQKIATMLFVPPEKGEAFWTESARTAFVGIASWIAAKSERPFSFGEIYRTITMPGMKAFFAK
EAGDSALSEGCRAALSDFTSSADNTFTGIIQTVTSKLNLWINPIVDRATAESDFSLTDLRRIPTSIYLGV
SPDELDRVAPLYNLFFQQLIDLNTRQLPDESEKLSVLLILDEFARLGRAQVIANAFSYVRGYGLRLLPVI
QSRSQLRNVYGEHGADEIVSNCGVEIAFTPKELRVAKELSERLGYLGQDAESRSLTIHGLLANRSKTISE
QRRALMLPQELMQLPEDDILVIRGGIPVIRGKKIRYFKDSVFRSRLTTAPAVPALPKPVAPIVPVDDLSD
EELAAFNDYSALADDQVQDIPEDVLALDRDMPNLTVKDGSMAFDEIDFDDIIGPDPTKEEWEGQRRDLVL
SEGEEYGR
 
Nucleotide Sequence: 1917 bp     [Download]
>gi|114883608|ref|NC_008330.1|:c54640-52724 Uncultured bacterium plasmid pLB1 DNA, complete sequence
TTGATCCAGAAAACAGGCTCTAACAGGCTCGCACTGGCCCTCGTCCTCCTTCCGATCACGCTCCTGCTGA
TCGGCCTGCTGACCGGCACGGTGGCGTGGTTCTTCCTCAAGATGCCCGCCGCGGCTTATGATCCGCTCAA
GCTCCCCGGCTTCTTCTGGTATTACCGGCATGATCCTGTCGTGACCGAAGCGCTTTGGCGAGGCGCGGTC
ATAGGCGTGCCGCTGCCGGTATTGCTCATGGCGATCGTCCTGCGGCCGAAAAAGAACCTTCACGGTGAAG
CTCGTTTCGCGCGCGAAGGTGAAATCCGCAAGGCGGGCCTTCGCGCGAAAAAGGGCATTGTGCTCGGCCG
CGTCCGCAATGGTTTTTTCCGCAACGGCTTTCTCATGGTGGGTAAGATGGAGCATGTATTGCTCGAAGCC
CCTACCGGATCGGGCAAGGGCGTCGGCATCGTTATTCCCAATCTGTTGCAATGGCCGGATTCGGTTGTCG
TGCTCGATATTAAGCGTGAGAACTACGAAATCACGGCGGGTTTCCGCCGCAAGGGCGGCCAAAAGGTTGT
GCTGTTCAACCCTACGGACAGAGAAGGCCGCACGGCCCGCTACAACCCGCTTAGCTACATCAACAGGGCC
GATCCAATTGAGGTCCTGGTCGAATTGCAGAAGATCGCGACGATGCTCTTCGTGCCCCCGGAGAAGGGCG
AGGCATTCTGGACAGAATCAGCCCGCACGGCCTTTGTCGGCATTGCATCATGGATCGCGGCCAAGTCTGA
ACGTCCCTTCTCGTTTGGCGAGATATACCGGACCATCACGATGCCGGGGATGAAGGCATTCTTCGCCAAG
GAAGCTGGCGATAGTGCGCTATCGGAAGGGTGCCGCGCCGCGTTGAGCGATTTTACGTCCAGCGCGGACA
ACACATTCACCGGCATTATCCAGACCGTCACCTCGAAGCTCAATCTCTGGATCAATCCCATTGTCGATCG
CGCGACGGCCGAAAGCGACTTTTCCCTGACGGACCTTCGCCGCATCCCGACCTCGATCTATCTCGGCGTT
TCGCCGGATGAACTCGATAGGGTCGCGCCGCTCTACAATCTGTTTTTCCAACAGCTGATCGACCTCAACA
CGCGGCAACTGCCCGACGAAAGCGAAAAGCTGTCCGTGCTGCTCATTCTGGACGAATTTGCGCGGCTCGG
CCGCGCCCAGGTCATTGCAAATGCGTTCTCCTATGTGCGCGGCTATGGGCTTCGTCTGCTTCCCGTCATC
CAGTCCCGCTCCCAGCTGCGGAATGTCTATGGTGAGCATGGCGCGGACGAAATCGTATCAAACTGCGGGG
TCGAAATTGCCTTCACGCCCAAGGAGCTGCGGGTCGCAAAGGAACTGTCCGAACGCCTCGGCTATCTCGG
TCAGGATGCGGAAAGCCGGTCCCTGACGATACATGGATTGCTCGCCAATCGAAGCAAGACAATCTCCGAA
CAGCGGCGCGCACTGATGCTCCCTCAAGAGCTGATGCAGCTGCCCGAAGACGATATTCTCGTCATCCGGG
GCGGTATCCCCGTCATTCGCGGGAAGAAAATCCGCTATTTCAAGGATTCCGTTTTCCGCTCGCGCCTGAC
GACTGCCCCGGCAGTGCCGGCGCTGCCCAAGCCGGTCGCGCCGATCGTGCCCGTCGATGATCTGAGCGAT
GAAGAGCTGGCGGCTTTCAACGATTATTCCGCACTGGCCGATGACCAGGTGCAGGACATTCCCGAAGACG
TTCTCGCCCTCGATCGCGACATGCCGAACCTCACGGTGAAGGACGGCAGCATGGCTTTCGATGAAATCGA
CTTCGACGACATTATTGGTCCCGATCCGACGAAAGAGGAATGGGAAGGTCAGCGCCGGGATCTAGTTCTA
AGTGAAGGAGAAGAATATGGCCGATAA
 Primer design