SecReT4
Protein ID: 114883646
T4SS name [ID]VirB [30]
Gene symbolvirB11
Locus tagD763_p2044
StrainPlasmid pLB1
Repliconplasmid pLB1 [GenBank: NC_008330] [Browse all T4SS(s) in this replicon]
Location [Strand]54618..55610 [-]
ProductVirB11 type IV secretion protein
Component typeVirB11
UniProt IDQ0KKK8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.6e-76, Aligned region: 12..312
Mg_chelatase [PF01078], Evalue: 2.9e-05, Aligned region: 153..198
Protein Sequence: 330 a.a.     [Download]
>gi|114883646|ref|YP_740336.1| VirB11 type IV secretion protein [uncultured bacterium]
MSNTAVLENALLPLRPLLAREDVTELVINKAGEAAIETRDGWSWETLPDLNEKSLLALARAAAAFTHQDI
SQSTPICSTILPSGERVQLVVPPAVPAGTVSITIRKPSSVTLTMEDFERGGLFSETKIATRQVSPLDVEL
RDLLDAGKHVEFFQKAVQGRKNILISGATGSGKTTLSKGLIQLIPPHERLLTIEDTRELVVPHRNVVHML
YAKDKQGTAKISAKDLLESALRMRPDRILLQELRDGTAFFYLRNVNSGHPGSITTIHADSAELAFEQLTL
LVKESEGGADLARDDIRSLLKLLVDVVVQTKKVEGRFRVTEIYFDPENRL
 
Nucleotide Sequence: 993 bp     [Download]
>gi|114883608|ref|NC_008330.1|:c55610-54618 Uncultured bacterium plasmid pLB1 DNA, complete sequence
ATGAGCAATACGGCTGTCCTCGAAAACGCCTTGCTGCCGCTGCGCCCTCTGCTCGCGCGTGAGGACGTAA
CGGAGCTGGTGATTAACAAGGCTGGCGAGGCTGCGATTGAAACGCGCGATGGGTGGTCCTGGGAGACATT
GCCCGACCTCAATGAAAAGTCGCTGCTCGCGCTCGCGCGGGCAGCGGCGGCGTTCACGCATCAGGACATA
AGCCAATCCACGCCGATCTGCTCCACAATCCTCCCCAGCGGCGAGCGTGTGCAGCTGGTAGTGCCACCTG
CTGTGCCTGCCGGCACAGTGTCCATCACGATCCGCAAGCCATCATCGGTGACGTTGACGATGGAGGATTT
CGAGCGCGGTGGGCTGTTTAGCGAGACAAAGATCGCAACCCGGCAAGTCTCGCCGCTCGATGTTGAATTG
CGCGATCTGCTCGACGCAGGAAAGCACGTCGAATTTTTCCAAAAGGCAGTCCAGGGCCGCAAGAATATCC
TGATTTCTGGCGCTACCGGCTCGGGAAAGACGACGCTCTCTAAGGGGCTGATCCAGCTCATTCCGCCGCA
TGAGCGTCTGCTGACGATCGAAGACACGCGCGAACTGGTGGTCCCGCATCGTAACGTGGTCCACATGCTC
TACGCGAAGGACAAGCAGGGCACCGCGAAAATCTCTGCAAAGGATCTTCTGGAATCGGCCCTGCGTATGC
GGCCTGACCGGATACTGTTGCAGGAGCTGCGCGACGGCACCGCGTTCTTCTATCTCCGCAACGTCAACTC
GGGCCATCCTGGCTCGATCACGACGATCCATGCGGACTCGGCCGAACTCGCGTTCGAACAGCTGACATTG
CTGGTCAAGGAAAGCGAGGGCGGCGCCGATCTGGCCCGTGACGACATTCGCAGCCTGCTCAAGCTGCTGG
TTGATGTGGTCGTGCAGACCAAGAAGGTCGAAGGCCGCTTTCGCGTGACGGAGATATATTTTGATCCAGA
AAACAGGCTCTAA
 Primer design