SecReT4
Protein ID: 114883649
T4SS name [ID]VirB [30]
Gene symbolvirB8
Locus tagD763_p2038
StrainPlasmid pLB1
Repliconplasmid pLB1 [GenBank: NC_008330] [Browse all T4SS(s) in this replicon]
Location [Strand]57716..58399 [-]
ProductVirB8 type IV secretion protein
Component typeVirB8
UniProt IDQ0KKK5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1e-57, Aligned region: 16..223
Protein Sequence: 227 a.a.     [Download]
>gi|114883649|ref|YP_740339.1| VirB8 type IV secretion protein [uncultured bacterium]
MAVGIPKDELKAYFEEAASWERDKLAAAERSKKLAWVVAGVAGALATAGVVAVAALTPLKTVEPYVITVD
RNTGEASIAAKLHGDATITYDEAVRKYFLATYVRYREGWIAAAREEYFDAVMVMSARPEQDRWSRFYKTD
NPQSPQNILANRTDVFVEIKRVSFLGGNVAQVYFTKESVTGSNSTKTDAVATIKYKVDGTPSKEVDRFKN
PLGYQVESYRADVEVPQ
 
Nucleotide Sequence: 684 bp     [Download]
>gi|114883608|ref|NC_008330.1|:c58399-57716 Uncultured bacterium plasmid pLB1 DNA, complete sequence
ATGGCAGTTGGTATTCCAAAGGACGAGCTGAAAGCCTATTTTGAAGAGGCTGCAAGCTGGGAACGTGACA
AGCTTGCGGCGGCCGAGCGCTCCAAAAAGCTGGCGTGGGTCGTCGCTGGCGTTGCTGGCGCCCTGGCGAC
TGCTGGCGTTGTGGCCGTTGCAGCCCTGACGCCTCTGAAAACGGTCGAGCCATATGTTATCACGGTGGAC
CGTAACACGGGCGAGGCGTCGATCGCCGCCAAGCTCCACGGTGACGCGACGATCACCTATGACGAGGCGG
TCCGTAAGTATTTCCTCGCAACCTATGTTCGCTATCGCGAAGGCTGGATAGCAGCCGCTCGCGAAGAATA
TTTCGATGCGGTCATGGTCATGTCAGCGCGGCCCGAACAGGATCGGTGGTCGCGCTTCTACAAGACTGAC
AATCCCCAAAGTCCGCAAAACATCTTGGCGAACCGCACCGATGTTTTTGTCGAAATCAAGCGGGTGTCAT
TCCTGGGCGGCAATGTCGCGCAGGTCTATTTCACCAAAGAATCTGTGACCGGCTCGAACTCGACCAAAAC
CGATGCCGTCGCGACCATCAAATACAAGGTCGATGGCACGCCGAGCAAGGAAGTGGACCGCTTCAAGAAT
CCGCTTGGCTATCAGGTCGAGAGCTATCGTGCTGACGTGGAGGTGCCCCAATGA
 Primer design