SecReT4
Protein ID: 115345517
T4SS name [ID]Trb [76]
Gene symbol-
Locus tagBamb_6625
StrainBurkholderia ambifaria AMMD
Repliconplasmid 1 [GenBank: NC_008385] [Browse all T4SS(s) in this replicon]
Location [Strand]32885..34603 [-]
ProductTrbL/VirB6 plasmid conjugal transfer protein
Component typeTrbL
UniProt IDQ0B105
KEGG IDbam:Bamb_6625
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.6e-38, Aligned region: 65..279
Protein Sequence: 572 a.a.     [Download]
>gi|115345517|ref|YP_771702.1| TrbL/VirB6 plasmid conjugal transfer protein [Burkholderia ambifaria AMMD]
MRMPANLKTLALPLFVWLAFFAVDAHAAIDNAGVFDSVLDRYQAAASGWAGVITTAATWLFWTLVVISMV
WTFGMMALRKADIGEFFAEFVRFTIFTGFFWWALTNGPNFASSIYASLRQLAGNATGLGNALSPSGIVDV
GFAIFDKVMDQSSVWSPVDSMAGILMAVAILVILALVGVNMLLLLASGWVLAYGGVFFLGFGGSRWTSDM
AINYYKVVLGVAAQLFAMVLLVGIGKTFLDDYYSRMSAGISLKEMGVMLIVVIILLALVNKIPPLIAGII
TGASVGGAGIGQFGAGAALGAAGMAAAAAATGGAALAAGAASAAGGASAVMAAFSKANENVSAGTDVMSA
FSGGGSSGGGAGGGGDAGTGSTPFAQAAGFSGSSGGGSSSGGGSPSTGSSSGSSKGGDKGGGKADAGGQG
SSSTASTGSSADKAAKNEPKPAGGAGQGQQAAPGSTGPGLLASAASALGTAGRIAADAGANLAKGTADVA
KAKAASLREAAAERIADTTGGKIAAAIKAQGSGTAENIDVPDQQPAPSFGDNSLAGGPADADPESEVAAF
ANREQGRDGTTA
 
Nucleotide Sequence: 1719 bp     [Download]
>gi|115345482|ref|NC_008385.1|:c34603-32885 Burkholderia cepacia AMMD plasmid 1, complete sequence
ATGAGAATGCCAGCCAATCTAAAAACCCTCGCCCTGCCGCTGTTCGTCTGGCTGGCGTTCTTCGCGGTCG
ATGCCCACGCGGCCATCGACAACGCCGGCGTGTTCGATAGCGTGCTGGATCGCTACCAGGCCGCCGCGAG
CGGCTGGGCCGGTGTCATCACCACGGCCGCAACCTGGCTCTTCTGGACGCTGGTTGTGATCTCGATGGTC
TGGACGTTCGGCATGATGGCCTTGCGCAAGGCCGACATTGGCGAGTTCTTCGCGGAGTTCGTCCGCTTCA
CGATCTTTACCGGCTTCTTCTGGTGGGCGCTGACCAACGGCCCTAACTTCGCCTCGTCCATCTATGCGTC
GTTGCGGCAGCTCGCCGGCAACGCGACGGGCCTGGGCAATGCTCTGTCGCCCTCGGGCATCGTGGACGTG
GGCTTTGCGATCTTCGACAAGGTGATGGATCAGTCCTCGGTGTGGTCGCCGGTGGACAGCATGGCCGGCA
TCCTCATGGCCGTGGCGATCCTGGTCATCCTGGCCCTGGTCGGTGTGAATATGCTTCTGCTGCTCGCGTC
GGGCTGGGTGCTCGCCTACGGCGGCGTGTTCTTCCTCGGCTTCGGTGGTTCGCGCTGGACTTCCGACATG
GCGATCAACTACTACAAGGTCGTCCTGGGCGTGGCCGCGCAGCTCTTCGCAATGGTGCTCCTGGTGGGCA
TCGGCAAGACCTTCCTCGATGACTACTACTCGCGCATGAGCGCCGGCATCAGCCTCAAGGAAATGGGCGT
GATGCTGATCGTCGTCATCATCCTCTTGGCGTTGGTCAACAAGATTCCGCCGCTCATCGCCGGGATCATC
ACCGGCGCGAGCGTGGGCGGTGCCGGCATCGGCCAGTTCGGTGCAGGCGCTGCGTTGGGTGCCGCAGGCA
TGGCAGCAGCAGCGGCCGCGACCGGCGGCGCCGCTCTGGCCGCCGGCGCAGCCTCGGCCGCCGGTGGTGC
CTCTGCCGTCATGGCCGCCTTCTCGAAGGCCAATGAGAACGTGTCGGCAGGCACGGACGTTATGTCGGCC
TTCTCGGGCGGCGGCAGCTCGGGCGGCGGTGCGGGCGGCGGCGGCGACGCCGGCACCGGCAGCACGCCCT
TCGCTCAGGCTGCGGGCTTTAGCGGCAGCTCCGGCGGTGGCTCTTCGTCGGGTGGCGGCAGCCCCTCGAC
CGGCAGCAGCTCGGGCAGCTCGAAGGGCGGCGATAAGGGCGGCGGCAAAGCCGACGCCGGCGGCCAGGGC
AGCAGCTCGACGGCCAGCACCGGCAGCAGTGCCGACAAGGCCGCCAAGAACGAACCCAAGCCCGCCGGCG
GGGCAGGGCAAGGGCAGCAGGCCGCACCGGGCAGCACCGGCCCCGGCTTGCTCGCATCGGCCGCATCGGC
CCTCGGCACGGCCGGCCGCATCGCCGCCGACGCCGGCGCGAACTTGGCGAAGGGAACCGCCGATGTTGCC
AAGGCCAAAGCCGCGAGCCTGCGCGAAGCCGCAGCCGAGCGGATCGCCGACACCACTGGCGGAAAGATCG
CCGCCGCGATCAAGGCGCAAGGAAGCGGCACGGCCGAGAACATCGACGTGCCCGACCAGCAGCCCGCGCC
GAGCTTCGGCGACAACAGCCTGGCAGGCGGCCCCGCCGATGCCGATCCCGAGTCCGAAGTAGCTGCGTTC
GCCAACCGCGAGCAAGGCCGCGACGGCACAACTGCGTAA
 Primer design