SecReT4
Protein ID: 115345522
T4SS name [ID]Trb [76]
Gene symbol-
Locus tagBamb_6630
StrainBurkholderia ambifaria AMMD
Repliconplasmid 1 [GenBank: NC_008385] [Browse all T4SS(s) in this replicon]
Location [Strand]37553..38452 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ0B100
KEGG IDbam:Bamb_6630
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.4e-66, Aligned region: 73..298
Protein Sequence: 299 a.a.     [Download]
>gi|115345522|ref|YP_771707.1| conjugal transfer protein TrbG/VirB9/CagX [Burkholderia ambifaria AMMD]
MKKTLSALIVGAAVAVPSLALAAPGDDIADKYFNKTNPTLTAQERAALAIAKRWEAGSATGIKPVAGSGG
AIKFVYGAQQPSIVCAVLQVCDVALQPGEQVNSINLGDTARWTVEPAITGSGATEVQHLIIKPMDVGLET
SLVVTTNRRSYHFRLRSHRTEYMPQVSFTYPEEAQAKWDAIQRREKQERTDNTLPATGEYLGDLSFDYEL
SGSASWKPVRVYNDGRKTIIEMPGTMQQTEAPTLLVVRKEGGLFTDDETVLVNYRVQGNRYIVDTVFDRA
ILIAGVGSSQDRVTISRRK
 
Nucleotide Sequence: 900 bp     [Download]
>gi|115345482|ref|NC_008385.1|:c38452-37553 Burkholderia cepacia AMMD plasmid 1, complete sequence
ATGAAGAAAACCCTCTCCGCTTTGATCGTGGGCGCTGCTGTGGCGGTGCCCTCCCTGGCTCTGGCCGCCC
CTGGCGACGACATTGCCGACAAGTATTTCAACAAGACCAACCCGACGCTGACCGCTCAAGAGCGCGCGGC
GCTCGCCATCGCCAAACGGTGGGAAGCGGGGTCGGCGACCGGCATCAAGCCGGTGGCCGGCTCGGGCGGT
GCCATCAAGTTCGTGTACGGCGCGCAGCAGCCGAGCATCGTTTGCGCGGTGCTCCAGGTGTGCGACGTGG
CCTTGCAGCCCGGCGAACAAGTGAACTCGATCAACCTGGGCGACACGGCCAGGTGGACGGTGGAACCGGC
CATCACCGGCAGCGGCGCGACCGAGGTTCAGCACCTCATCATCAAGCCGATGGACGTGGGCCTCGAAACC
AGCCTGGTTGTGACCACGAACCGCCGCAGCTACCACTTCCGCCTGCGCTCGCATCGCACCGAGTACATGC
CGCAAGTCTCGTTCACGTACCCCGAGGAAGCGCAAGCCAAGTGGGACGCGATCCAGCGCCGCGAGAAGCA
GGAACGCACCGACAACACCCTGCCGGCGACGGGCGAGTACCTGGGCGATCTCTCGTTCGACTATGAGCTG
TCCGGGTCGGCGAGCTGGAAGCCTGTGCGCGTCTACAACGATGGCCGCAAGACCATCATCGAAATGCCCG
GCACGATGCAGCAGACCGAAGCGCCGACGCTCCTGGTCGTGCGCAAAGAGGGCGGCTTGTTCACCGACGA
CGAAACGGTGCTGGTCAATTACCGCGTGCAGGGCAATCGCTACATCGTGGACACGGTGTTTGACCGCGCG
ATCCTGATTGCCGGTGTTGGCAGTAGCCAAGACCGCGTGACCATCAGCCGGAGGAAGTGA
 Primer design