SecReT4
Protein ID: 115345526
T4SS name [ID]Trb [76]
Gene symbol-
Locus tagBamb_6634
StrainBurkholderia ambifaria AMMD
Repliconplasmid 1 [GenBank: NC_008385] [Browse all T4SS(s) in this replicon]
Location [Strand]42119..42583 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ0B0Z6
KEGG IDbam:Bamb_6634
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2e-18, Aligned region: 12..110
Protein Sequence: 154 a.a.     [Download]
>gi|115345526|ref|YP_771711.1| conjugal transfer protein TrbC [Burkholderia ambifaria AMMD]
MQATFPAFRLNRNALFYMGLFALLAFFLLAPQHAFASEGTGGSLPYESWLTNLRNSVTGPVAFALSIIGI
VVAGGILIFGGELNGFFRTLIFIVLVMALLVGAQNMMSTFFGRGAEIAALTDGALHQVKVAALDVAGFPG
EAVMRWAERGHIAG
 
Nucleotide Sequence: 465 bp     [Download]
>gi|115345482|ref|NC_008385.1|:c42583-42119 Burkholderia cepacia AMMD plasmid 1, complete sequence
ATGCAAGCAACCTTCCCGGCATTCCGCCTCAACCGCAACGCCCTGTTCTACATGGGCCTCTTCGCCCTCC
TGGCGTTCTTCCTGCTGGCCCCCCAGCACGCATTCGCCTCCGAGGGCACCGGCGGCTCTCTGCCGTATGA
GAGCTGGCTGACCAACCTCCGCAACTCCGTCACCGGCCCGGTGGCCTTCGCGCTGTCGATCATCGGCATC
GTGGTCGCCGGCGGCATCCTGATCTTCGGCGGCGAACTCAACGGCTTCTTCCGCACGTTGATCTTCATCG
TCCTGGTCATGGCCCTGCTGGTCGGCGCGCAGAACATGATGAGCACGTTCTTCGGCCGTGGCGCGGAAAT
CGCCGCCCTGACCGATGGCGCGCTGCACCAGGTCAAGGTCGCCGCGCTGGACGTGGCCGGCTTCCCCGGC
GAAGCCGTCATGCGCTGGGCCGAGCGCGGCCACATCGCGGGGTAA
 Primer design