SecReT4
Protein ID: 115345537
T4SS name [ID]VirB [474]
Gene symbolvirB11
Locus tagRD1_A0007
StrainRoseobacter denitrificans OCh 114
Repliconplasmid pTB1 [GenBank: NC_008386] [Browse all T4SS(s) in this replicon]
Location [Strand]7740..8723 [-]
Producttype IV secretory pathway, VirB11 component, putative
Component typeVirB11
UniProt IDQ07GT8
KEGG IDrde:RD1_A0007
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.2e-65, Aligned region: 13..311
Protein Sequence: 327 a.a.     [Download]
>gi|115345537|ref|YP_771719.1| type IV secretory pathway, VirB11 component, putative [Roseobacter denitrificans OCh 114]
MSGPQSHAEFGLLPLRDLLTSDEVNEVVVNPDGSIWVEYANREHMALVAVSLPENQVRAIGSHLAGETKN
ALGKDHPIVSGRVFVFGQSVRVQVIVPPAVEQGISLSIRKYINRVIGVSEIVFLDGAQVDVAQERRDKLE
KIDQLAKAGHLSALFQVAIDERLNILISGGTSSGKTTTARGLLGITDLQERVVTIEDAAELMPPHKNQVP
LIADRIKGSVRSPASLLESSLRMRPDRLILGEIRGVEALNFLEAINTGHPGSISTIHADTPALALERMAL
MAMQSGLQLTMQDVIAYASQTIDMIVQVGRKGGKRGVMEIYIPALQG
 
Nucleotide Sequence: 984 bp     [Download]
>gi|115345530|ref|NC_008386.1|:c8723-7740 Roseobacter denitrificans plasmid pTB1, complete sequence
TTGAGCGGCCCTCAATCCCACGCCGAATTTGGTCTGCTGCCATTGCGGGATCTCCTGACGTCGGATGAGG
TCAATGAGGTCGTCGTCAATCCAGATGGCTCGATCTGGGTGGAATACGCCAACCGCGAACACATGGCACT
GGTCGCGGTCTCTTTGCCTGAAAACCAGGTTCGCGCTATCGGTTCACACTTGGCTGGGGAGACGAAGAAC
GCCCTCGGCAAGGATCATCCCATCGTTTCAGGGCGCGTCTTTGTGTTCGGCCAGTCTGTCCGCGTTCAGG
TCATTGTGCCGCCTGCTGTCGAGCAAGGGATTTCGCTCTCCATTCGCAAATACATCAACCGGGTCATCGG
CGTTTCCGAGATCGTGTTTCTGGACGGTGCGCAGGTCGATGTGGCGCAAGAACGGCGCGACAAGCTGGAA
AAGATCGACCAACTGGCCAAAGCGGGCCACTTGAGCGCATTGTTCCAGGTCGCGATAGATGAGCGACTGA
ACATCCTGATTTCCGGCGGGACAAGCTCAGGTAAAACCACCACGGCGCGCGGGCTGCTTGGCATCACCGA
CCTTCAGGAGCGGGTTGTGACCATCGAGGACGCGGCAGAACTCATGCCGCCGCATAAAAACCAAGTGCCG
TTGATTGCGGATCGTATCAAAGGCTCGGTCAGATCGCCCGCCAGTCTGCTGGAAAGCAGCCTGCGGATGC
GCCCGGATCGCTTGATCCTGGGTGAGATACGCGGCGTTGAAGCGCTCAATTTCCTTGAGGCAATCAATAC
CGGCCATCCGGGGTCCATCTCGACCATCCATGCCGACACCCCTGCCCTGGCCCTGGAGCGTATGGCCCTG
ATGGCCATGCAATCCGGGTTGCAGCTCACCATGCAGGACGTGATCGCCTATGCCTCGCAAACCATCGACA
TGATTGTCCAAGTCGGCCGCAAAGGCGGCAAGCGCGGCGTCATGGAAATCTACATACCTGCGTTGCAGGG
ATGA
 Primer design