SecReT4
Protein ID: 115345540
T4SS name [ID]VirB [474]
Gene symbol-
Locus tagRD1_A0010
StrainRoseobacter denitrificans OCh 114
Repliconplasmid pTB1 [GenBank: NC_008386] [Browse all T4SS(s) in this replicon]
Location [Strand]10806..11480 [-]
ProductVirB8 protein
Component typeVirB8
UniProt IDQ07GT5
KEGG IDrde:RD1_A0010
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 7.2e-52, Aligned region: 9..215
Protein Sequence: 224 a.a.     [Download]
>gi|115345540|ref|YP_771722.1| VirB8 protein [Roseobacter denitrificans OCh 114]
MPRQTTDYTFQDEVFFQLRRQRNIAVWTSALSLSIALTSVAAVSLMLPFKEIRPYVVMVDRETGMAEQIT
ATRPADLSEREAVREAELVRYVTERETYDVSDNPIRIPLVLQTSDEQAADSLRTLWNSANEAYPPDRYGR
DVLITVIVRNINALDDNTAQVRFTRRLERPGMPAIERSFVATVGFEFRPRVERRLEDVWRNPLGFTVVSY
RIAAETLTPQGTGQ
 
Nucleotide Sequence: 675 bp     [Download]
>gi|115345530|ref|NC_008386.1|:c11480-10806 Roseobacter denitrificans plasmid pTB1, complete sequence
ATGCCAAGGCAAACAACAGACTATACCTTCCAGGATGAGGTGTTTTTTCAGCTTCGGCGTCAGAGAAACA
TCGCGGTCTGGACAAGCGCGCTGAGCCTGTCGATCGCGCTTACCTCCGTGGCGGCTGTCAGCCTCATGCT
GCCCTTCAAGGAAATCAGGCCCTACGTCGTCATGGTGGACCGCGAGACCGGCATGGCCGAACAGATCACC
GCCACGCGCCCCGCTGATCTGAGTGAGCGCGAGGCGGTCAGGGAAGCCGAACTGGTCCGGTATGTGACCG
AACGGGAAACCTATGACGTCTCTGACAATCCCATACGGATCCCCCTGGTGCTGCAAACCTCGGATGAGCA
AGCCGCAGACAGCCTCCGAACGCTCTGGAACTCGGCCAATGAAGCCTATCCGCCGGACCGCTATGGCCGC
GACGTGCTGATTACTGTGATCGTGCGCAACATCAACGCGCTCGATGACAACACGGCACAGGTGCGCTTCA
CGCGCCGTCTTGAGCGTCCCGGCATGCCCGCCATCGAACGCAGCTTTGTGGCCACCGTCGGCTTTGAGTT
TCGCCCCCGCGTGGAACGTCGCCTCGAAGATGTCTGGCGCAACCCGCTGGGCTTTACCGTGGTCAGCTAC
CGCATCGCGGCAGAAACCCTCACACCACAAGGAACGGGTCAATGA
 Primer design