SecReT4
Protein ID: 115345635
T4SS name [ID]VirB [474]
Gene symbol-
Locus tagRD1_A0114
StrainRoseobacter denitrificans OCh 114
Repliconplasmid pTB1 [GenBank: NC_008386] [Browse all T4SS(s) in this replicon]
Location [Strand]104010..106175 [+]
Producttype IV secretion system protein VirD4
Component typeVirD4
UniProt IDQ07GJ0
KEGG IDrde:RD1_A0114
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 4.7e-106, Aligned region: 95..535
TraG-D_C [PF12696], Evalue: 6.9e-31, Aligned region: 388..505
TrwB_AAD_bind [PF10412], Evalue: 1.1e-26, Aligned region: 134..519
AAA_10 [PF12846], Evalue: 1e-09, Aligned region: 138..463
Protein Sequence: 721 a.a.     [Download]
>gi|115345635|ref|YP_771817.1| virD4 protein, putative [Roseobacter denitrificans OCh 114]
MNKTTADVLVFAGVGAIVGSVPALVAAGACALWLSGLSITTVELDTLLYFAPWITGSIEPFKTAALAGGA
VWLVSVIAAVAIGYRPQLASHGSARWAEERDLKKAGLVAPLAEVQGPVFAKFGSPNKRRAYLTSTEIPHS
LIAAPTGSGKGIGIVIPTLLTYNGSVVCLDVKGENFETTSRHRAAMGDAVFKFAPYDKDGRTHRYNPIDI
VTHVADRRRFTEARRLASSLIIAKSKSAEGFLEGAREIFAASVVYAIEQETPTIAAVHDLISQHGQAHSN
FETMAAKAQAPEAVSIFNRMASTDIRTLSAYLSVLSDGGLSLWADPAVRDATAQSDFTFTNLRRQPASIY
FVVGPNDLDPLSSLIRLMFQQAVAITQREMPKADEPFPVLFLLDEFASLGRMDALSQAITTLRGYGGRLM
IIVQSLSNLQIYGQDGAQNFLANCRLQLFMAPADKDTPDYISRAIGDFTRRARSKSWQTNDFMKSNVQER
EEGARLIRPEELRKLGEDTIVALIQNQDPVRTDKVKYYEDKELCPIFEAQTGPLPEPPSLFEGDEADTRI
RLFVAAHDPGLIDDTEARRKHLPAPDPSSTKEAPAKVILLPPPDAPASPPPSEPDYDASTRKDVGPTQPT
PAPVATETTNSVPKPLSKRMRAIARAKAASKARSLDEDMDEDLEAAAVQDLKDHLTTHSPVQRAIEKARL
RAEVNWPDAYGDNKPLRKRGA
 
Nucleotide Sequence: 2166 bp     [Download]
>gi|115345530|ref|NC_008386.1|:104010-106175 Roseobacter denitrificans plasmid pTB1, complete sequence
ATGAACAAAACCACCGCAGATGTTCTCGTCTTCGCCGGCGTCGGCGCTATTGTCGGGTCGGTCCCGGCCC
TTGTTGCCGCCGGGGCCTGTGCGCTGTGGCTTTCCGGCCTGAGCATCACAACCGTTGAGCTGGACACGCT
TCTCTATTTTGCGCCCTGGATCACCGGCAGCATTGAACCTTTCAAGACCGCCGCGCTCGCGGGTGGTGCT
GTCTGGCTGGTGTCCGTTATAGCCGCCGTCGCCATCGGCTATCGTCCCCAGCTAGCCAGTCACGGATCTG
CGCGGTGGGCCGAGGAACGGGACTTGAAGAAGGCGGGCCTGGTGGCCCCGCTCGCGGAGGTGCAGGGACC
GGTATTCGCGAAGTTCGGGTCGCCCAACAAAAGACGCGCCTATCTGACATCCACCGAGATTCCGCATAGC
CTCATTGCAGCACCAACAGGCTCGGGCAAGGGCATCGGGATCGTGATCCCAACTCTTCTGACCTACAACG
GGTCCGTGGTCTGTCTGGACGTCAAGGGCGAGAACTTTGAGACAACGTCGCGGCACCGGGCCGCAATGGG
TGATGCGGTGTTCAAGTTTGCGCCCTATGACAAAGACGGGCGCACCCATCGCTACAACCCGATTGACATC
GTGACACATGTGGCGGATCGGCGGCGTTTCACAGAGGCGCGCCGCCTTGCATCCAGCCTTATCATTGCAA
AATCCAAAAGTGCCGAAGGCTTTCTGGAAGGGGCCAGAGAGATTTTTGCGGCCTCCGTGGTGTACGCAAT
CGAGCAGGAGACCCCGACGATTGCCGCCGTGCACGACCTGATATCGCAGCACGGACAGGCGCACTCGAAC
TTCGAGACAATGGCGGCCAAGGCTCAGGCGCCCGAAGCGGTGTCGATCTTCAACCGGATGGCCTCGACCG
ACATCCGGACGCTGAGCGCCTATTTGTCAGTGTTGTCGGATGGCGGCCTGAGCCTTTGGGCCGACCCGGC
GGTGCGGGATGCGACCGCGCAGTCCGATTTTACCTTCACCAATCTGCGACGTCAGCCTGCGTCGATTTAT
TTTGTTGTCGGCCCGAATGATTTGGACCCGCTGTCGTCGCTCATTCGCCTCATGTTCCAGCAAGCGGTTG
CCATCACGCAGCGGGAAATGCCGAAAGCGGATGAGCCGTTCCCGGTTTTGTTTCTCTTGGATGAATTTGC
CTCCCTCGGGCGCATGGATGCTTTGAGCCAGGCCATCACCACGTTACGAGGATACGGCGGGCGCTTGATG
ATCATTGTTCAATCGCTGTCGAACTTGCAGATTTACGGGCAGGACGGTGCGCAGAATTTCCTCGCAAACT
GCCGCCTTCAGCTTTTCATGGCCCCGGCGGACAAGGACACGCCGGATTATATCTCGCGCGCGATCGGTGA
TTTCACCCGCAGGGCGCGCAGTAAATCATGGCAGACCAATGACTTCATGAAGTCCAACGTGCAGGAGCGC
GAAGAAGGGGCCAGGCTCATTCGGCCCGAGGAACTGCGTAAATTGGGCGAGGACACGATTGTTGCGCTGA
TCCAGAACCAGGACCCGGTACGCACCGACAAGGTGAAATACTACGAAGACAAGGAGCTGTGCCCGATCTT
TGAAGCACAGACCGGCCCGCTGCCAGAGCCTCCCAGCCTCTTTGAGGGCGACGAAGCAGATACACGTATA
CGTCTATTCGTGGCGGCACATGATCCCGGCCTCATTGACGACACAGAGGCGCGTCGCAAGCACCTTCCTG
CACCCGACCCGTCCAGCACCAAAGAAGCGCCAGCCAAGGTCATATTGCTACCACCTCCGGACGCACCAGC
ATCACCGCCACCGTCTGAACCAGATTACGATGCGTCGACCAGAAAGGATGTGGGGCCAACCCAGCCCACA
CCGGCACCGGTGGCAACAGAAACCACAAACAGCGTACCGAAACCACTGTCCAAACGCATGCGCGCGATTG
CACGTGCAAAAGCAGCATCCAAAGCAAGAAGTCTCGACGAAGACATGGATGAAGATCTGGAAGCCGCCGC
CGTACAGGATTTGAAGGACCACCTGACAACGCATTCGCCGGTGCAGCGAGCGATTGAAAAAGCGCGCCTT
CGCGCCGAGGTAAACTGGCCAGATGCTTATGGCGACAATAAACCTTTGCGGAAACGGGGCGCGTGA
 Primer design