SecReT4
Protein ID: 115352039
T4SS name [ID]Trb [303]
Gene symbol-
Locus tagBamb_1988
StrainBurkholderia ambifaria AMMD
Repliconchromosome 1 [GenBank: NC_008390] [Browse all T4SS(s) in this replicon]
Location [Strand]2183996..2184583 [+]
ProductType IV secretory pathway protease TraF-like protein
Component typeTraF
UniProt IDQ0BE79
KEGG IDbam:Bamb_1988
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 7.6e-52, Aligned region: 46..190
Protein Sequence: 195 a.a.     [Download]
>gi|115352039|ref|YP_773878.1| Type IV secretory pathway protease TraF-like protein [Burkholderia ambifaria AMMD]
MTIVSTSSASPRPRSRLRARLVLAALTACGLAALAWAAFVSPLPRLTYNPSDSVAVGWYRIEPFDPRTAT
LPRPLSVDSIVLMPLPADVAALAAQRGYLPTHVPLLKRVGAVAPQHVCNFAGQVRIDGVPSAAALPADQL
GRPLPSLQLCRRLAPGELFLLSATNPASFDSRYFGPVNAATVIGVAHPVWLEARP
 
Nucleotide Sequence: 588 bp     [Download]
>gi|115350056|ref|NC_008390.1|:2183996-2184583 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGACGATCGTTTCCACTTCATCCGCCTCGCCGCGTCCTCGCTCACGCCTGCGCGCTCGTCTCGTGCTGG
CGGCCCTGACCGCCTGCGGCCTCGCTGCGCTGGCCTGGGCGGCTTTCGTGTCGCCGCTACCTCGCCTGAC
GTACAACCCATCCGACAGCGTGGCGGTCGGCTGGTATCGCATCGAACCGTTCGACCCGCGCACCGCCACG
CTGCCACGTCCGTTGTCCGTGGACAGCATCGTGTTGATGCCCCTGCCAGCCGACGTCGCGGCACTCGCTG
CGCAGCGCGGCTATCTGCCGACGCACGTTCCGCTGCTCAAACGTGTGGGCGCGGTCGCACCGCAACACGT
TTGCAACTTCGCTGGTCAGGTTCGCATCGACGGCGTGCCTTCGGCCGCCGCACTGCCTGCCGACCAGCTG
GGCCGGCCGCTGCCATCCTTGCAGCTTTGCCGGCGCCTCGCGCCTGGCGAACTGTTCTTGTTGAGCGCAA
CGAATCCGGCGTCTTTCGACAGCCGGTATTTCGGCCCGGTCAACGCTGCTACCGTGATCGGCGTTGCGCA
CCCCGTTTGGCTGGAGGCACGCCCGTGA
 Primer design