SecReT4
Protein ID: 115352053
T4SS name [ID]Trb [303]
Gene symbol-
Locus tagBamb_2002
StrainBurkholderia ambifaria AMMD
Repliconchromosome 1 [GenBank: NC_008390] [Browse all T4SS(s) in this replicon]
Location [Strand]2198164..2200161 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ0BE65
KEGG IDbam:Bamb_2002
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.6e-103, Aligned region: 111..558
TraG-D_C [PF12696], Evalue: 2.8e-31, Aligned region: 404..524
TrwB_AAD_bind [PF10412], Evalue: 1.4e-30, Aligned region: 172..539
Protein Sequence: 665 a.a.     [Download]
>gi|115352053|ref|YP_773892.1| conjugal transfer coupling protein TraG [Burkholderia ambifaria AMMD]
MQAQGVLFGQIAVVFSIVIAGVWSATQWTAAALAYQLRLGSPWFDFFGMPVYHPWRLFEWWFFFDAYAPH
VFDIGGAIAGGSGLVAVVVAIAMSVWRSRQSRLVTTYGSARWANTADIRKAGLMQPAGVLLGLHDGQYLR
HEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKGENWQITAGWRSRFSHCLLFNPTDAKSAAYN
PLLEVRRGAHEVRDVQNIADILVDPEGALEKRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPA
CPFELTLHRMMTTKHLGDAPHTVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIA
DLIASESPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGRDGIERRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLGTATELRAQRN
YAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDESVVMVSSVAPIKAKKLRYYADTNFKQRVLPPPA
LAAGRYADVPPTRADDWSGLAIPAVPAASATASADDLGGTDDGGPRRQPELSESVAYDPELDPPDDLALL
DDDDDLPLPLPGQLDLAMQRTARLASLDPNDGIDL
 
Nucleotide Sequence: 1998 bp     [Download]
>gi|115350056|ref|NC_008390.1|:2198164-2200161 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGCAAGCTCAGGGCGTGTTGTTCGGGCAGATCGCGGTTGTTTTCAGCATCGTGATCGCCGGTGTGTGGA
GTGCAACGCAATGGACAGCCGCCGCTCTGGCCTACCAACTACGCCTTGGCTCGCCCTGGTTCGATTTCTT
CGGAATGCCGGTCTATCACCCCTGGCGGCTGTTCGAGTGGTGGTTCTTCTTCGATGCCTACGCGCCGCAC
GTCTTCGATATAGGCGGCGCCATTGCGGGCGGCAGCGGCCTGGTGGCCGTGGTGGTCGCCATCGCCATGT
CGGTGTGGCGCTCGCGGCAATCGCGCCTGGTCACGACCTATGGCTCAGCACGTTGGGCCAACACCGCCGA
CATTCGCAAAGCCGGGTTGATGCAGCCTGCCGGCGTCCTTCTCGGCCTCCATGACGGACAGTACCTGCGC
CATGAAGGCCCGGAACACGTCCTGACCTTCGCGCCCACGCGCTCTGGCAAAGGCGTGGGCCTGGTGGTGC
CGACGCTGCTGTCATGGCCTGCCTCGGCCGTCATCCACGACATCAAGGGCGAGAACTGGCAGATCACCGC
CGGCTGGCGTTCGCGCTTCTCGCATTGCCTGCTGTTCAACCCCACCGATGCGAAGTCAGCCGCGTACAAC
CCGCTGCTGGAGGTACGGCGAGGCGCTCATGAAGTGCGCGACGTACAGAACATCGCGGACATCCTTGTCG
ATCCCGAAGGGGCGCTGGAGAAGCGCAATCACTGGGAGAAGACCAGCCATGCGCTGCTGGTCGGCGCCAT
CCTGCATGTGCTCTACGCCGGCGAAGACAAGACGCTGCGCGGCGTCGCCAACTTCCTCTCCGATCCTGCG
TGCCCGTTCGAGCTGACGCTGCATCGGATGATGACGACGAAGCACCTGGGCGATGCACCGCACACGGTTG
TCGCGTCCGCCGCGCGTGAAGTGCTCAACAAGTCGGACAACGAGCGGTCGGGCGTGCTCTCGACTGCGAT
GAGCTTCTTGGGCTTGTACCGCGACCCCACGGTGGCCGAGGTCACCTCACGCTGCGACTGGCGCATCGCC
GACCTGATCGCGTCCGAGTCACCCGTGTCGCTGTACCTGGTGGTGCCGCCTTCGGACATCAGCCGCACCA
AGCCGTTGATCCGGCTCATCTTGAACCAGATCGGGCGACGCCTCACCGAATCGCTCGATGGCAGAGACGG
CATCGAACGCCGCCACAAGCTGTTGCTGATGCTCGATGAGTTTCCGGCGCTGGGCCGGCTCGACTTCTTC
GAGACGGCGCTTGCCTTCATGGCCGGCTACGGCATCCGCAGCTTCCTCATCGCACAGTCGCTCAACCAGA
TCGACAAAGCCTACGGCCAGAACCATTCGATTCTGGACAACTGCCATGTCCGGGTGACGTTCGCCACGAA
CGATGAACGCACGGCCAAACGCATTTCAGAGACCTTGGGTACGGCGACCGAACTGCGCGCGCAGCGCAAC
TACGCCGGCCACCGGCTCGCGCCGTGGCTCGGGCATCTCATGGTGTCGCGGCAGGAGACGGCCCGCCCGC
TGCTCACCCCTGGCGAAGTGATGCAGCTCCCGCCCGATGAATCCGTGGTGATGGTGTCCAGCGTGGCGCC
GATCAAGGCCAAGAAGCTGCGCTACTACGCCGACACCAATTTCAAACAGCGGGTACTACCACCGCCTGCG
CTTGCGGCCGGGCGGTACGCCGACGTGCCACCGACCCGCGCCGACGACTGGAGCGGCCTGGCGATTCCGG
CCGTGCCCGCCGCATCGGCCACGGCATCCGCCGATGACCTGGGCGGCACCGATGACGGCGGTCCGCGCCG
CCAACCCGAACTCTCCGAATCCGTCGCTTACGACCCCGAGCTGGATCCGCCCGATGACCTGGCGCTGCTC
GATGACGACGACGACTTGCCGCTGCCGCTTCCCGGCCAGCTTGACCTGGCCATGCAGCGCACGGCGCGGC
TGGCCTCCCTCGACCCCAACGACGGAATCGACTTATGA
 Primer design