SecReT4
Protein ID: 115352055
T4SS name [ID]Trb [303]
Gene symbol-
Locus tagBamb_2004
StrainBurkholderia ambifaria AMMD
Repliconchromosome 1 [GenBank: NC_008390] [Browse all T4SS(s) in this replicon]
Location [Strand]2200631..2201677 [+]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDQ0BE63
KEGG IDbam:Bamb_2004
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.3e-82, Aligned region: 33..299
TrwB_AAD_bind [PF10412], Evalue: 2.2e-06, Aligned region: 155..192
FtsK_SpoIIIE [PF01580], Evalue: 1.5e-05, Aligned region: 152..222
Protein Sequence: 348 a.a.     [Download]
>gi|115352055|ref|YP_773894.1| type II secretion system protein E [Burkholderia ambifaria AMMD]
MSAVPQIPPEPRSSATTSQNRRIQMLRTAMGPLIAAALEDPDVVEIMLNPDRSLWVDRLSSGRAPLGVEL
PEADGERIIRLVAAHVGAEVHRGRPLLTAELPETGERFEGILPPAAPGPAFALRKRAVSIIGLDRYVADG
ILTAGQADFLRRAVRERQNILIAGGTSTGKTTLANALLAEIAATGDRVLVLEDTIELQCAARDHVPLRTR
AGVVSMQELVRATMRLRPDRVIVGEVRGGEALDLIKVWGTGHPGGIATIHAGSALGALLRLEQLILEVAV
NPPRALIAEAINVVIHIAGRGRKRHVESIARVVGFDGAGYRMADALEMPFPELPPVPSPSPEPSGELP
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|115350056|ref|NC_008390.1|:2200631-2201677 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGAGCGCCGTTCCACAGATCCCGCCAGAACCACGCTCGTCGGCCACCACTTCACAGAATCGCCGCATCC
AGATGCTGCGCACGGCAATGGGGCCGCTGATCGCCGCCGCGCTCGAAGACCCGGACGTGGTGGAAATCAT
GCTCAACCCCGACCGCAGCCTATGGGTCGATCGGCTGTCGTCGGGCCGTGCGCCGCTGGGCGTCGAACTG
CCCGAGGCCGATGGCGAACGCATCATTCGCCTGGTGGCCGCCCACGTCGGTGCAGAGGTGCATCGCGGCC
GACCATTGCTGACCGCCGAGCTGCCCGAAACCGGCGAGCGGTTCGAGGGCATCCTGCCCCCGGCCGCACC
CGGCCCGGCCTTCGCGCTGCGCAAGCGCGCCGTGAGCATCATCGGCCTGGATCGCTACGTCGCCGACGGC
ATCCTGACTGCCGGCCAGGCCGACTTCCTGCGCCGCGCCGTGCGCGAGCGCCAGAACATCCTGATCGCCG
GCGGCACCAGTACCGGCAAGACCACGCTCGCCAACGCGCTGCTGGCCGAGATCGCCGCCACCGGTGACCG
CGTGCTGGTGCTCGAAGACACCATCGAGCTGCAATGCGCCGCCCGCGACCATGTGCCGCTGCGCACGCGC
GCGGGCGTGGTGTCGATGCAGGAGCTGGTGCGCGCCACGATGCGCCTGCGCCCCGACCGCGTGATCGTCG
GCGAGGTGCGCGGCGGCGAGGCGCTTGATCTCATCAAGGTGTGGGGCACCGGCCACCCCGGCGGCATCGC
CACGATTCACGCCGGTTCCGCCTTGGGCGCGCTGCTGCGCCTGGAGCAACTGATTCTCGAAGTGGCGGTG
AATCCGCCGCGCGCGTTGATCGCCGAGGCCATCAACGTCGTCATCCACATCGCCGGGCGTGGCCGCAAGC
GCCACGTCGAAAGCATCGCACGCGTCGTCGGTTTCGACGGCGCGGGCTATCGCATGGCGGATGCGCTGGA
AATGCCGTTTCCCGAGCTGCCGCCAGTTCCTTCCCCGTCCCCTGAACCCTCTGGAGAACTGCCATGA
 Primer design