SecReT4
Protein ID: 115352056
T4SS name [ID]Trb [303]
Gene symbol-
Locus tagBamb_2005
StrainBurkholderia ambifaria AMMD
Repliconchromosome 1 [GenBank: NC_008390] [Browse all T4SS(s) in this replicon]
Location [Strand]2201674..2202057 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ0BE62
KEGG IDbam:Bamb_2005
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.4e-23, Aligned region: 31..117
Protein Sequence: 127 a.a.     [Download]
>gi|115352056|ref|YP_773895.1| conjugal transfer protein TrbC [Burkholderia ambifaria AMMD]
MTQMHIHAFRISVNPASAFARLRRLAAPAQHGLMLAAVMLMTAGTAQAAGSSMPWEGPLTSILESIQGPV
ARIVAVIIIISTGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 384 bp     [Download]
>gi|115350056|ref|NC_008390.1|:2201674-2202057 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGACGCAGATGCACATTCATGCTTTCCGCATTTCCGTAAATCCGGCTTCGGCCTTCGCACGCCTGCGTC
GCCTGGCCGCGCCGGCGCAGCACGGCCTGATGCTGGCCGCCGTCATGCTGATGACGGCTGGCACCGCGCA
GGCCGCCGGTTCCTCGATGCCCTGGGAAGGGCCACTAACCTCCATCCTCGAATCCATCCAGGGGCCGGTG
GCACGCATCGTCGCGGTCATCATCATTATTTCCACCGGCCTGGCGCTGGCCTTCGGCGATACCAGCGGCG
GCTTCCGCAAGCTGATCCAGATCGTCTTCGGCCTGTCCATCGCGTTCGCAGCTTCGAGCTTCTTCCTGTC
GTTCTTCAGCTTCTCCGGCGGGGCCGTCGTATGA
 Primer design