SecReT4
Protein ID: 115352057
T4SS name [ID]Trb [303]
Gene symbol-
Locus tagBamb_2006
StrainBurkholderia ambifaria AMMD
Repliconchromosome 1 [GenBank: NC_008390] [Browse all T4SS(s) in this replicon]
Location [Strand]2202054..2202338 [+]
Productputative conjugal transfer trbD transmembrane protein
Component typeTrbD
UniProt IDQ0BE61
KEGG IDbam:Bamb_2006
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3e-11, Aligned region: 17..87
Protein Sequence: 94 a.a.     [Download]
>gi|115352057|ref|YP_773896.1| putative conjugal transfer trbD transmembrane protein [Burkholderia ambifaria AMMD]
MTAANEGAPAFASGFEIPLHRSLTEPILLGGAPRTVAIANGTLAAAVGLGLQLWIPGVVLWIVGHSLAVW
GARVDPQFMQVFARHIKHKPLLDV
 
Nucleotide Sequence: 285 bp     [Download]
>gi|115350056|ref|NC_008390.1|:2202054-2202338 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGACCGCCGCCAACGAAGGAGCGCCGGCCTTCGCGTCCGGTTTCGAGATCCCGCTGCATCGCTCACTGA
CCGAGCCGATCCTGCTGGGCGGTGCGCCGCGCACCGTGGCGATTGCCAACGGCACGCTGGCCGCCGCCGT
CGGGCTGGGCCTGCAATTGTGGATTCCCGGTGTGGTGCTGTGGATCGTCGGCCATTCGCTGGCGGTGTGG
GGCGCGCGCGTCGATCCGCAGTTCATGCAGGTCTTCGCCCGGCACATCAAGCACAAGCCGCTGCTGGACG
TGTAG
 Primer design