SecReT4
Protein ID: 115352058
T4SS name [ID]Trb [303]
Gene symbol-
Locus tagBamb_2007
StrainBurkholderia ambifaria AMMD
Repliconchromosome 1 [GenBank: NC_008390] [Browse all T4SS(s) in this replicon]
Location [Strand]2202351..2204801 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDQ0BE60
KEGG IDbam:Bamb_2007
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3.2e-38, Aligned region: 442..711
CagE_TrbE_VirB [PF03135], Evalue: 3.2e-15, Aligned region: 299..388
DUF853 [PF05872], Evalue: 6.2e-08, Aligned region: 593..684
Protein Sequence: 816 a.a.     [Download]
>gi|115352058|ref|YP_773897.1| conjugal transfer ATPase TrbE [Burkholderia ambifaria AMMD]
MLNLAEYRQRPALLADWLPWAGLIAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRRLG
SGWALFIEAERRPAADYPHSDFPEPLSWLVDEERRAAFEESGHHFESGYHLTLAHLPPEESRARAAKLLY
ENAPGDGVDWHGRLDAFVAETDRVFDLLDGVMPEIARLDDAQTLTYLHATVSTRRYRVGVPEVPFHIDAL
LADSALVGGLAPTLGDQHLRVVSVRGFPTSTWPGLLDDLNRLGFAYRWSTRFLCLDKAEAEKELGRLRRQ
WFAKRKNVVALLRETIFQQESPLVDTDASNKAADADAAMQELGGDQVAFGYFTATVTVLDADSAAADEKL
RMVERVIQGRGFVTIPETLNVVDAWLSSIPGNAYANVRQPIVSTLNLAHMMPLSAVWAGPEKNDHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLAILVQQFRRYRGSRVFAFDMGRSMRATILGLG
GEHYDLGADGGIAFQPLARIDRESYRSWAGEWVEGRLLHEGVTVGPDEKAVIWSALGSLTGAPVEQRTLT
GLSVLLQSNALRQALAPYVLGGAHGKLLDADTDRLGFGDVQGFEMEELMHSPAAVQAVLRYLFARFDERF
DGAPTLLILDEAWLFLDEPSFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCPSRIFLPN
PQATEPQIRTIYEGFGLNSRQIEIVATAQPKRDYYYQSRLGNRLFDLDLGPAALAFAGASTPQDQRDMDR
VLTQAGAPGFAGAWLRHRGLDWASDLLPSSPAAASFLNSQPLEVSP
 
Nucleotide Sequence: 2451 bp     [Download]
>gi|115350056|ref|NC_008390.1|:2202351-2204801 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGCTGAACCTTGCCGAATACCGCCAGCGCCCGGCCTTGCTCGCCGACTGGCTTCCGTGGGCCGGCTTGA
TCGCGCCGGGCGTGGTGCTGAACAAGGATGGCAGTTTCCAGCGTACAGCGCGCTTTCGCGGGCCTGATCT
GGACAGCGCCACGCAAGGCGAACTGATCGCCACATCGGCGCGTCTCAACAACGCGCTTCGCCGCCTGGGT
TCGGGCTGGGCCCTGTTCATTGAGGCCGAACGCCGCCCGGCGGCGGACTACCCGCATTCCGATTTCCCCG
AGCCGCTGTCCTGGCTCGTGGACGAGGAACGCCGCGCCGCCTTCGAGGAATCGGGGCATCACTTCGAGAG
CGGCTATCACCTGACGCTGGCGCACCTGCCGCCCGAGGAATCACGCGCCCGCGCGGCCAAGCTGCTCTAC
GAGAACGCGCCCGGCGATGGCGTGGATTGGCATGGCCGGCTCGATGCCTTCGTGGCGGAAACCGATCGTG
TTTTCGACTTGCTCGATGGCGTGATGCCGGAGATCGCCCGGCTCGATGACGCCCAGACGCTGACCTACCT
GCACGCCACGGTGTCCACGCGGCGCTACCGCGTGGGCGTACCTGAAGTGCCGTTCCATATCGACGCGCTG
CTGGCCGACTCCGCGCTGGTCGGCGGCCTGGCGCCCACGCTGGGCGACCAGCACCTGCGCGTGGTGTCGG
TGCGGGGCTTTCCGACCTCGACCTGGCCGGGCCTGCTGGACGACCTCAACCGCCTGGGCTTTGCCTATCG
CTGGAGCACGCGCTTTCTCTGCCTGGACAAAGCCGAAGCAGAAAAGGAACTCGGCCGCCTGCGCCGCCAG
TGGTTTGCCAAGCGCAAGAACGTCGTCGCGCTGCTGCGCGAAACCATCTTCCAGCAGGAAAGCCCGCTGG
TCGATACCGACGCGAGCAACAAGGCGGCCGACGCGGATGCCGCGATGCAGGAGCTGGGTGGCGATCAGGT
CGCCTTCGGTTACTTCACTGCCACGGTGACGGTGCTCGATGCCGATTCAGCCGCGGCCGACGAAAAGCTG
CGCATGGTGGAGCGCGTCATCCAGGGCCGGGGTTTCGTGACCATCCCCGAGACGTTGAATGTCGTGGATG
CGTGGCTGTCGTCCATCCCCGGCAATGCCTACGCGAATGTCCGCCAGCCCATCGTCTCGACGCTGAACTT
GGCGCACATGATGCCGCTGTCTGCGGTGTGGGCCGGGCCGGAGAAGAACGACCACCTCGACGGCCCGCCG
CTGATCGTCACCCGCACCGATGGTGCGACGCCGTTCCGGCTGGTGACACACATCGGCGACGTCGGCCACA
CGCTGGTCGCCGGGCCGACCGGCATGGGCAAGTCGGTGTTGCTTGCCATTCTGGTGCAGCAATTCCGCCG
CTATCGCGGCTCTCGCGTGTTCGCTTTCGATATGGGCCGCTCGATGCGCGCCACCATCCTGGGCCTGGGC
GGCGAGCACTACGACCTGGGTGCCGATGGCGGCATTGCCTTCCAGCCGCTCGCGCGTATCGACCGGGAAA
GCTATCGCTCCTGGGCGGGGGAATGGGTGGAAGGCCGCCTGCTGCATGAGGGCGTGACGGTCGGCCCGGA
CGAGAAGGCGGTCATCTGGTCGGCGCTGGGCAGCTTGACCGGTGCGCCGGTCGAGCAACGCACGTTGACC
GGGTTATCAGTACTGCTGCAATCGAACGCGCTACGGCAGGCACTCGCGCCTTATGTGCTCGGTGGCGCGC
ACGGCAAGCTACTGGACGCGGACACCGATCGTCTCGGCTTCGGTGACGTACAGGGCTTCGAGATGGAAGA
ACTGATGCACAGCCCCGCCGCCGTGCAAGCGGTGCTGCGCTACCTGTTCGCCCGCTTCGATGAGCGTTTC
GACGGTGCGCCCACGCTGCTGATTCTGGATGAGGCGTGGCTGTTCCTCGATGAGCCGTCTTTCGCCGCGC
GCATTCGCCAATGGTTGAAGACGCTGCGCAAGAAAAACGTGTCGGTGATCTTCGCCACGCAGTCGCTCGC
CGATATCAAGGATTCGAGCATTGCGCCCGCGATCATCGAGAGCTGCCCGAGTCGGATTTTTCTCCCCAAT
CCGCAGGCCACCGAGCCGCAGATTCGCACGATCTACGAGGGCTTCGGCCTCAACAGCCGGCAAATCGAAA
TCGTCGCTACCGCCCAGCCCAAGCGCGACTACTACTACCAATCGCGCCTCGGCAATCGCCTGTTCGACCT
TGATCTGGGTCCAGCCGCACTCGCCTTCGCGGGTGCATCTACTCCGCAAGACCAACGCGACATGGATCGC
GTGCTGACGCAGGCCGGCGCTCCCGGCTTCGCCGGTGCGTGGCTGCGCCATCGCGGCCTCGACTGGGCCT
CCGACCTGTTGCCGTCCTCACCGGCGGCCGCTTCGTTCCTCAACTCCCAACCACTGGAGGTTTCGCCATG
A
 Primer design