SecReT4
Protein ID: 115352059
T4SS name [ID]Trb [303]
Gene symbol-
Locus tagBamb_2008
StrainBurkholderia ambifaria AMMD
Repliconchromosome 1 [GenBank: NC_008390] [Browse all T4SS(s) in this replicon]
Location [Strand]2204798..2205535 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ0BE59
KEGG IDbam:Bamb_2008
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 245 a.a.     [Download]
>gi|115352059|ref|YP_773898.1| conjugal transfer protein TrbJ [Burkholderia ambifaria AMMD]
MKIRVLSASLAAALAGSLMLAQPAAALTFVDPVNLVQNTLTAIRTLEQINNQINQLQNEAQMLMNQARNL
ANLDFNIVNRLRSTLASTERLIVEAQGLAYDVQSMDATFARLYPEQYAATISGDRMAQDARERWKNTLDG
LHTAMRMQAQVSQNLAQDESALADLVSQSQSATGALQAQQATNQLLALQAKQSIQSQQLQITQDRAASLE
LARQAAATERAREVRRRFLRSGTPYTPQSINFYNN
 
Nucleotide Sequence: 738 bp     [Download]
>gi|115350056|ref|NC_008390.1|:2204798-2205535 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGAAGATCCGTGTGCTTTCCGCTTCGCTCGCCGCCGCGCTGGCCGGCTCGCTGATGCTCGCTCAGCCGG
CGGCGGCGCTGACCTTCGTTGATCCCGTCAACTTGGTGCAGAACACGCTGACCGCCATCCGCACCCTTGA
GCAGATCAACAATCAGATCAATCAGCTTCAGAACGAAGCGCAGATGTTGATGAACCAGGCGCGCAACTTG
GCGAATCTCGATTTCAACATCGTCAACCGCCTGCGCTCCACGCTCGCCAGCACCGAACGCCTGATCGTCG
AGGCGCAGGGACTGGCCTACGACGTGCAGAGCATGGATGCCACGTTCGCCCGTCTGTACCCGGAGCAGTA
CGCCGCGACCATCAGCGGCGACCGCATGGCGCAGGACGCCCGCGAACGCTGGAAGAACACGCTCGATGGC
CTGCATACCGCGATGCGGATGCAGGCACAGGTGTCGCAGAACCTGGCACAAGACGAAAGCGCACTGGCCG
ATCTGGTCAGCCAGAGCCAGTCCGCCACCGGCGCCTTGCAGGCGCAGCAGGCGACCAACCAGCTTCTTGC
CTTGCAGGCCAAGCAGTCCATCCAGTCCCAGCAACTCCAGATCACGCAAGACCGCGCGGCCTCGCTGGAA
CTGGCGCGGCAGGCGGCGGCCACCGAGCGCGCCCGCGAAGTGCGGCGGCGCTTCCTTCGCAGCGGCACGC
CGTACACGCCGCAGTCCATCAATTTCTACAACAACTGA
 Primer design