SecReT4
Protein ID: 115352061
T4SS name [ID]Trb [303]
Gene symbol-
Locus tagBamb_2010
StrainBurkholderia ambifaria AMMD
Repliconchromosome 1 [GenBank: NC_008390] [Browse all T4SS(s) in this replicon]
Location [Strand]2205876..2207270 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ0BE57
KEGG IDbam:Bamb_2010
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.5e-49, Aligned region: 37..264
Protein Sequence: 464 a.a.     [Download]
>gi|115352061|ref|YP_773900.1| conjugal transfer protein TrbL [Burkholderia ambifaria AMMD]
MNDVTIIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIVIDMTIAGLYWAMSHATGQGEDVIAKLLRKVLY
VGAFAYIIGNFNWLAGIVFRSFAGLGLTATGSAMTMENFLQPGRLAKTGIDAGAPILEQIGDMAGFPEVF
VNIDPIVVMFLAWLTVILCFFVLAIQLFITLIEFKLTTLAGFVLVPFALWNKTSFLAEKVLGNVVSSGIK
VLVLAVIVGIGSGLFAEFQVHPDEPSIDHALVVMLASLALLALGIFGPGIATGLVSGAPQLGAGAMAGAA
VGAAGTAVAIGAAATGLGGAVVAGARMAPAAAKLAGAGARAATSAAGSARLAFQAGSAAAGGGARGAMAG
SSNVAKTGAQSFGRSAASGASGAAQKMTGSFRAGWNGTEAGGGAASGAAGSGQAAAGEATDSAASSQKQE
QPAWAKRMHRRQQITHAATTAAHTLRGGDGGGSGQGPSLRGSDD
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|115350056|ref|NC_008390.1|:2205876-2207270 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGAACGACGTGACCATCATCGACCGATTCCTCGATACGTTCTCGCGCTACATCGACTCCGGGTTCGGGC
TGCTGCAAGGCGAAGTGGCGTTCCTGACAGCCACGCTGATCGTCATCGACATGACCATCGCCGGCCTTTA
TTGGGCCATGAGCCACGCCACCGGCCAGGGCGAGGACGTGATCGCCAAGCTGCTGCGCAAGGTGCTCTAC
GTCGGTGCCTTCGCCTACATCATCGGCAACTTCAACTGGCTGGCCGGGATCGTTTTCCGCTCGTTCGCCG
GCCTGGGCCTGACGGCCACCGGCTCGGCCATGACGATGGAGAACTTTCTTCAGCCGGGCCGGCTGGCCAA
GACCGGTATCGACGCGGGCGCACCGATTCTGGAGCAGATCGGCGACATGGCGGGCTTCCCCGAAGTCTTC
GTGAACATCGACCCCATCGTGGTGATGTTCCTCGCCTGGCTCACCGTCATCCTGTGTTTCTTCGTGCTGG
CGATCCAGCTTTTCATCACGCTGATCGAGTTCAAGCTGACCACGCTCGCGGGCTTCGTGCTGGTGCCGTT
CGCGCTTTGGAACAAGACCTCGTTTCTCGCCGAAAAGGTTCTCGGCAATGTGGTGTCGTCGGGCATCAAG
GTCTTGGTGCTGGCCGTCATCGTCGGCATCGGCTCGGGCCTGTTCGCGGAGTTCCAGGTTCATCCCGACG
AGCCTTCCATCGACCACGCCCTTGTCGTGATGCTGGCCTCGCTCGCGTTGCTGGCGCTGGGCATCTTCGG
CCCCGGCATCGCCACGGGTCTGGTGTCCGGTGCGCCGCAGCTTGGCGCAGGCGCGATGGCGGGTGCCGCC
GTTGGTGCCGCCGGCACGGCCGTTGCCATCGGCGCCGCCGCGACTGGCTTGGGCGGTGCGGTCGTGGCCG
GGGCACGCATGGCGCCTGCTGCCGCCAAGCTGGCTGGTGCCGGTGCGCGTGCCGCCACCTCGGCGGCCGG
CAGCGCACGCTTGGCGTTCCAGGCCGGTTCCGCCGCTGCGGGCGGCGGCGCCAGGGGCGCAATGGCCGGC
TCGAGCAATGTCGCCAAGACCGGCGCGCAGTCTTTCGGGCGCAGCGCTGCATCCGGGGCTTCCGGCGCTG
CGCAGAAGATGACCGGCTCTTTCCGTGCTGGATGGAACGGTACAGAGGCCGGTGGCGGCGCTGCGTCCGG
TGCGGCTGGCTCCGGTCAGGCGGCCGCAGGCGAAGCCACAGACAGCGCCGCCAGCTCGCAGAAGCAAGAG
CAGCCCGCCTGGGCCAAGCGGATGCACCGCCGCCAGCAGATCACCCATGCCGCGACCACTGCCGCACACA
CGTTGCGCGGTGGCGATGGCGGCGGCTCCGGGCAAGGCCCGAGCCTGCGCGGCTCCGACGACTAA
 Primer design