SecReT4
Protein ID: 115352062
T4SS name [ID]Trb [303]
Gene symbol-
Locus tagBamb_2011
StrainBurkholderia ambifaria AMMD
Repliconchromosome 1 [GenBank: NC_008390] [Browse all T4SS(s) in this replicon]
Location [Strand]2207295..2207999 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ0BE56
KEGG IDbam:Bamb_2011
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.3e-62, Aligned region: 22..225
Protein Sequence: 234 a.a.     [Download]
>gi|115352062|ref|YP_773901.1| conjugal transfer protein TrbF [Burkholderia ambifaria AMMD]
MRFKRPQVRYADTPQPATPYQAAAQVWDERIGSARVQAKNWRLMAFGCLVLALLMAGGLVWRSAQSIVTP
YVIEVDQSGQVRTVGEAATPYRPADAQIAHHLARFVTLVRSLSIDPIVVRQNWLDAYDYTTDKGAAVLND
YASKNDPFARVGRESVTVQITSVTRASDASFNVRWTEQRFVNGVPAGTERWNAVLSIVLQTPRTEQRLRK
NPLGIYVNGLSWSRELDSSEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|115350056|ref|NC_008390.1|:2207295-2207999 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGCGATTTAAACGACCGCAGGTGCGCTATGCCGATACGCCGCAGCCTGCCACCCCATATCAAGCTGCCG
CCCAAGTGTGGGACGAGCGCATCGGCTCGGCCCGCGTACAGGCGAAGAACTGGCGGCTGATGGCCTTTGG
CTGCCTAGTGCTGGCCTTGCTGATGGCCGGCGGCCTGGTGTGGCGTTCGGCGCAGTCCATCGTGACGCCC
TACGTCATTGAAGTCGATCAGTCCGGCCAGGTGCGTACCGTGGGCGAAGCCGCTACGCCGTACCGGCCCG
CCGATGCGCAGATCGCGCATCACCTGGCGCGCTTCGTGACGCTGGTGCGTTCGCTGTCCATCGACCCCAT
CGTCGTGCGGCAGAACTGGCTCGATGCCTATGACTACACCACCGACAAGGGCGCGGCCGTGCTCAACGAC
TACGCGAGCAAGAACGATCCGTTCGCCCGCGTCGGCCGCGAGTCGGTGACGGTGCAGATCACCAGCGTCA
CGCGCGCGAGCGATGCCTCGTTCAACGTCCGCTGGACGGAGCAGCGGTTCGTCAATGGCGTACCCGCTGG
CACCGAACGCTGGAATGCCGTGCTTTCCATCGTCCTGCAAACCCCGCGTACCGAACAGCGCCTGCGCAAG
AACCCGCTGGGGATCTACGTCAACGGCCTGTCGTGGAGTCGCGAACTGGATTCTTCCGAAGGAGCCAAGC
CATGA
 Primer design