SecReT4
Protein ID: 115352063
T4SS name [ID]Trb [303]
Gene symbol-
Locus tagBamb_2012
StrainBurkholderia ambifaria AMMD
Repliconchromosome 1 [GenBank: NC_008390] [Browse all T4SS(s) in this replicon]
Location [Strand]2207996..2209000 [+]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDQ0BE55
KEGG IDbam:Bamb_2012
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.2e-67, Aligned region: 107..326
Protein Sequence: 334 a.a.     [Download]
>gi|115352063|ref|YP_773902.1| conjugal transfer protein TrbG/VirB9/CagX [Burkholderia ambifaria AMMD]
MNLPFRFYAFVLMFAAITSSLLGCASQGKPPPSISLDEPVQAQPLPELPKPVEVVAVPEPLALPAQLKPL
PEVGEAAPVPEPADEKVRVSRANAEARIAPTREGYVNAIQVWPYSDGALYQVYAAPGRVTVVSLQPGEEL
VTVAAGDTVRWIVGDTSSGSGEALRVNVLVKPTRSGLKTNLVITTSRRTYLLELTSTEKAWMASASWDYP
KDRMLALQRQSQAASAAAPVDTGLALEKIRFRYAISGSNPPWKPQRAFDDGEKVYIQFPPGIAQGELPPL
FVIGAQGDGQLVNYRFRSPYYIVDRLFGAAELRLGGDGSDVVRIERTDGVARRN
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|115350056|ref|NC_008390.1|:2207996-2209000 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGAACTTGCCTTTCCGCTTTTACGCTTTCGTGCTGATGTTCGCGGCCATCACGTCGTCATTGCTGGGCT
GCGCCTCGCAGGGCAAGCCGCCGCCGTCCATCTCGCTCGATGAGCCGGTGCAGGCCCAGCCGTTGCCCGA
ACTGCCCAAGCCGGTCGAAGTCGTCGCCGTGCCCGAGCCGCTGGCGCTGCCGGCGCAGTTGAAGCCGCTG
CCGGAGGTGGGCGAGGCAGCGCCCGTGCCCGAGCCGGCCGACGAGAAGGTGCGCGTCTCGCGCGCCAATG
CCGAGGCGCGCATCGCGCCGACCCGCGAGGGCTACGTCAACGCGATTCAGGTGTGGCCGTATAGCGACGG
CGCGTTGTATCAGGTCTATGCCGCGCCGGGGCGCGTCACCGTGGTTTCGCTCCAGCCCGGCGAGGAACTT
GTCACCGTCGCCGCTGGCGATACCGTGCGCTGGATCGTCGGCGACACGTCCAGCGGCAGCGGCGAGGCGC
TGCGCGTCAATGTGCTGGTCAAGCCCACCCGCTCGGGCCTGAAGACCAATCTGGTCATCACCACCAGCCG
GCGGACGTACTTGCTGGAACTGACCTCAACGGAAAAGGCATGGATGGCGTCGGCGTCATGGGACTACCCA
AAAGACCGGATGCTGGCCTTGCAGCGTCAATCGCAGGCGGCCAGCGCCGCCGCGCCGGTCGATACCGGCC
TGGCACTGGAGAAGATCCGCTTCCGCTACGCGATCAGCGGCAGCAATCCGCCGTGGAAGCCGCAGCGGGC
CTTCGATGATGGCGAGAAAGTCTATATCCAGTTCCCGCCGGGTATCGCCCAAGGCGAACTGCCGCCGCTG
TTCGTCATTGGCGCGCAGGGTGATGGTCAGCTCGTCAACTACCGTTTCCGTTCGCCGTACTACATCGTGG
ATCGCCTCTTTGGTGCGGCTGAACTGCGCTTGGGCGGCGATGGTAGTGACGTGGTGCGGATCGAGCGCAC
AGACGGCGTGGCGCGGAGGAACTGA
 Primer design