SecReT4
Protein ID: 115352064
T4SS name [ID]Trb [303]
Gene symbol-
Locus tagBamb_2013
StrainBurkholderia ambifaria AMMD
Repliconchromosome 1 [GenBank: NC_008390] [Browse all T4SS(s) in this replicon]
Location [Strand]2209003..2210286 [+]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDQ0BE54
KEGG IDbam:Bamb_2013
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.9e-58, Aligned region: 231..413
Protein Sequence: 427 a.a.     [Download]
>gi|115352064|ref|YP_773903.1| conjugation TrbI family protein [Burkholderia ambifaria AMMD]
MSQDDTPDLAAPQAAGKIAPEAVALRALPRPVTRLNRRTLAILTGGLSVAVLGALMWSLQPQRRGANEQA
ELYNVDRVSKSEGLDALPADYSKLPSALPPTVPELGPPLPGDLGPAIVKSQQPVTAAYAAPGNDPNDALR
KEAEAAAGSSVFFRSGTQKAAPVAQSQATAAPGFAANAAFDPMAAGPASTAAQPADLTAVQNRQDQKEAF
QKAGTTETRNSGNLALPASPYQVMAGTVIAGALVTGIKSDLPGDVIATVTEPVYDTATGRFLLIPQGSRI
LGRYNSQVSYGQSRVQVVWNRIILPDTSSLTLDNLVGADPAGYAGLEDDVDYHWGRIFAGAALTTLLGVG
AELAAPENRQDGDRIIIAGRDSAQDSINQVGQELTRRNMNIQPTLTERPGLPVRVIANRDLVLRPYQPLF
FNKGTSR
 
Nucleotide Sequence: 1284 bp     [Download]
>gi|115350056|ref|NC_008390.1|:2209003-2210286 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGAGCCAGGACGACACTCCCGACCTCGCCGCGCCGCAGGCGGCGGGCAAGATCGCGCCCGAGGCGGTGG
CGCTGCGCGCCCTGCCGCGCCCGGTCACGCGCCTGAATCGGCGCACGCTGGCCATCCTCACCGGCGGCCT
GTCGGTCGCCGTACTCGGCGCGCTGATGTGGTCGCTGCAACCACAGCGGCGCGGGGCCAACGAGCAGGCC
GAGCTTTACAACGTGGATCGCGTCTCCAAGTCCGAAGGATTGGACGCGCTGCCGGCGGATTACTCCAAGC
TGCCGTCGGCCTTGCCACCCACGGTACCCGAGCTGGGGCCGCCGCTGCCGGGCGATCTTGGCCCGGCCAT
CGTCAAGTCGCAGCAGCCGGTGACGGCCGCCTATGCGGCCCCTGGCAACGACCCGAACGATGCGCTGCGC
AAGGAAGCCGAAGCGGCCGCGGGTTCATCGGTGTTCTTTCGCTCTGGCACGCAGAAGGCCGCGCCGGTGG
CGCAGTCGCAGGCTACCGCCGCGCCGGGCTTCGCTGCCAATGCGGCGTTCGACCCGATGGCGGCCGGGCC
AGCCTCCACAGCGGCGCAGCCCGCCGACCTGACGGCGGTACAGAACCGGCAAGACCAGAAAGAGGCATTC
CAGAAAGCCGGAACCACGGAAACCCGTAATTCCGGCAACCTGGCCCTGCCGGCTTCGCCGTATCAGGTGA
TGGCCGGGACGGTCATCGCCGGTGCGCTGGTGACGGGCATCAAGTCGGATTTGCCGGGCGATGTGATCGC
CACGGTGACGGAGCCGGTCTATGACACGGCCACCGGGCGCTTTCTGCTGATCCCGCAGGGTTCACGCATC
CTGGGCCGCTACAACAGCCAGGTCAGCTACGGACAAAGCCGCGTTCAAGTCGTCTGGAACCGGATCATCC
TGCCCGACACGTCTTCGCTGACGCTCGACAACTTGGTCGGAGCCGACCCGGCTGGCTATGCCGGGCTGGA
AGATGACGTGGACTACCACTGGGGCCGCATCTTCGCCGGCGCGGCGCTGACCACGCTGCTGGGCGTCGGC
GCCGAGCTGGCCGCGCCCGAGAACCGCCAGGACGGCGACCGCATCATCATCGCCGGGCGCGACAGCGCGC
AGGACAGCATCAACCAGGTCGGCCAGGAGCTGACCCGGCGCAACATGAACATCCAGCCGACGCTGACCGA
GCGGCCGGGCCTACCGGTTCGCGTCATCGCCAACCGCGACTTGGTACTGCGGCCCTACCAGCCATTGTTC
TTCAACAAAGGGACTTCGCGATGA
 Primer design