SecReT4
Protein ID: 115526011
T4SS name [ID]Trb [283]
Gene symbol-
Locus tagRPE_4016
StrainRhodopseudomonas palustris BisA53
Repliconchromosome [GenBank: NC_008435] [Browse all T4SS(s) in this replicon]
Location [Strand]4500451..4501455 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDQ07JE2
KEGG IDrpe:RPE_4016
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.2e-68, Aligned region: 106..328
Protein Sequence: 334 a.a.     [Download]
>gi|115526011|ref|YP_782922.1| conjugal transfer protein TrbG/VirB9/CagX [Rhodopseudomonas palustris BisA53]
MMKSLLLRHAASPALLLSVSIVAGCTIPLKPPPDISYDNEAQPAVQMLDPPKPVEIVELPAPLPLPGQLK
PLKGARSKPELPDPRQRVEKANAAARVQPTRHGYINAVQVYPFSSGALYQVYAAPGQVTDVALQEGEQLV
GSGPVAAGDTVRWIIGDTESGAGPTKRIHILVKPTRPDLVSNLVINTDRRTYLLELRSAEKTYMASVSWQ
YPQDQLIALRRQNASAEAATPIVTGVDISRLRFRYAIEGDDPPWRPLSAFDDGSKVYIEMPSGIAQGEAP
PLFVIGPEGEGQLVNYRVRQNYYIVDRLFAAAELRMGGEHQQSVRISRTDGRGR
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|115522030|ref|NC_008435.1|:c4501455-4500451 Rhodopseudomonas palustris BisA53 chromosome, complete genome
ATGATGAAGTCACTGTTGTTGCGTCACGCTGCCTCGCCAGCTCTGCTGTTGTCGGTTTCGATTGTTGCGG
GATGCACCATTCCGCTCAAACCGCCACCGGACATCTCCTATGACAACGAGGCGCAGCCTGCCGTCCAGAT
GCTGGATCCGCCGAAACCGGTCGAGATCGTGGAATTGCCAGCGCCATTGCCGCTGCCGGGTCAATTGAAG
CCGCTGAAGGGCGCGCGTTCAAAGCCCGAGTTGCCCGACCCTCGCCAACGTGTCGAGAAGGCCAATGCCG
CTGCGCGCGTTCAACCGACTCGCCATGGTTACATCAATGCGGTGCAGGTCTATCCGTTCTCGTCCGGGGC
GCTGTATCAGGTCTATGCCGCGCCGGGTCAGGTGACCGATGTTGCTCTGCAGGAAGGCGAGCAACTCGTT
GGCTCCGGGCCGGTCGCCGCCGGCGACACCGTGCGCTGGATCATTGGCGACACCGAAAGCGGGGCAGGAC
CGACCAAACGTATCCATATCCTGGTGAAGCCGACCAGACCCGACCTCGTCTCCAATCTGGTCATCAACAC
CGATCGCCGCACTTATTTGCTTGAGCTGCGTTCCGCCGAGAAGACCTATATGGCCTCGGTGTCCTGGCAA
TACCCGCAGGATCAGCTGATTGCGCTGCGTAGGCAGAATGCGAGCGCGGAAGCCGCCACCCCGATCGTGA
CCGGCGTTGACATTTCGCGGCTGCGTTTCCGTTACGCGATCGAGGGCGATGACCCGCCCTGGCGTCCGCT
CTCCGCCTTCGATGACGGCTCCAAGGTTTACATCGAGATGCCTAGCGGGATAGCCCAGGGCGAGGCGCCG
CCGCTGTTCGTGATTGGCCCCGAAGGCGAGGGGCAACTAGTGAACTATCGCGTCCGGCAGAACTATTACA
TCGTCGATCGCCTGTTCGCCGCGGCGGAACTGCGCATGGGCGGCGAGCATCAGCAGAGCGTCCGGATCAG
CCGCACCGACGGGAGAGGGCGATGA
 Primer design