SecReT4
Protein ID: 115526013
T4SS name [ID]Trb [283]
Gene symbol-
Locus tagRPE_4018
StrainRhodopseudomonas palustris BisA53
Repliconchromosome [GenBank: NC_008435] [Browse all T4SS(s) in this replicon]
Location [Strand]4502132..4503307 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ07JE0
KEGG IDrpe:RPE_4018
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2e-51, Aligned region: 38..262
Protein Sequence: 391 a.a.     [Download]
>gi|115526013|ref|YP_782924.1| conjugal transfer protein TrbL [Rhodopseudomonas palustris BisA53]
MGGTGVIDRFLEVFTRYIDSGFGLLNGEVAFLATTLAAIDITLAAIFWSWAADEDIIARLAKKTLFVGVF
AYLIGNWNSLARIVFESLAGLGLKASGTGMSMADLLRPGRVAQVGIDAGRPILDSISSLLGYISFFENFV
QIVVLLFAWIVVLLAFFILAIQLFVTLIEFKLTTLAGFVLIPFGLFGKTAFAAERVLGNVISSGIKVLVL
AVIVGIGTTLFAQFTAGFGGNQPTIEDALTLVLAALSLLGLGIFGPGIANGLVSGGPQLGAGSAVGTGLA
AGGIVAAGAAGATMAAGAAGGVLAGGARGAAALMQPSGSIIASPLRRSAADQSGQGAASPGSSPSGSEPA
WATRMKRSQTVSHGASAAVHAVRSGDHGGGGASVDVSEGKS
 
Nucleotide Sequence: 1176 bp     [Download]
>gi|115522030|ref|NC_008435.1|:c4503307-4502132 Rhodopseudomonas palustris BisA53 chromosome, complete genome
ATGGGGGGCACCGGCGTCATTGACCGCTTTCTTGAGGTCTTCACCCGTTACATCGACTCCGGTTTCGGCC
TGCTCAATGGCGAAGTGGCATTCCTTGCCACGACGCTGGCAGCGATCGACATCACCCTTGCGGCGATCTT
CTGGAGCTGGGCAGCCGACGAAGATATCATAGCGCGGTTGGCGAAGAAGACGCTGTTCGTCGGCGTGTTC
GCTTACCTGATCGGCAATTGGAATAGCCTTGCCCGCATCGTCTTCGAGAGTCTTGCGGGGCTCGGCCTGA
AGGCGTCCGGCACCGGAATGTCGATGGCCGATCTGCTCAGGCCCGGCCGCGTCGCCCAGGTCGGCATCGA
TGCGGGGCGGCCCATCCTGGACTCGATCTCGAGCCTATTGGGTTACATCAGCTTCTTCGAGAATTTCGTT
CAGATCGTCGTTCTGTTGTTCGCCTGGATCGTGGTGCTGCTCGCCTTCTTCATCCTGGCGATCCAGCTGT
TCGTGACCCTGATCGAGTTCAAGCTGACGACGCTCGCAGGTTTCGTGCTGATCCCGTTCGGCCTGTTCGG
CAAGACGGCGTTCGCTGCCGAACGCGTGCTTGGCAACGTCATTTCATCCGGCATCAAGGTGCTGGTTCTT
GCCGTCATCGTCGGCATCGGCACCACGCTGTTTGCACAGTTCACCGCCGGATTCGGCGGCAACCAGCCGA
CCATCGAAGATGCGCTGACGCTGGTGCTCGCCGCATTGTCGTTGCTGGGCCTCGGCATTTTTGGTCCGGG
GATCGCCAACGGCCTTGTGTCGGGAGGCCCGCAACTCGGTGCAGGTTCGGCGGTCGGGACCGGTCTTGCG
GCGGGCGGCATCGTCGCTGCCGGTGCGGCCGGAGCGACGATGGCTGCCGGGGCCGCCGGCGGCGTCCTCG
CCGGGGGGGCGCGTGGTGCCGCCGCTTTGATGCAGCCGAGTGGCTCCATCATCGCCAGCCCGCTGCGCCG
AAGCGCAGCCGATCAATCAGGGCAGGGAGCAGCGTCGCCAGGTTCGTCGCCCTCTGGCAGTGAACCGGCG
TGGGCCACCCGCATGAAGCGCTCGCAAACCGTCAGCCACGGGGCTTCCGCCGCGGTCCATGCGGTCCGTT
CCGGTGATCATGGCGGCGGCGGCGCGTCGGTCGATGTTTCCGAGGGGAAAAGCTGA
 Primer design