SecReT4
Protein ID: 115526018
T4SS name [ID]Trb [283]
Gene symbol-
Locus tagRPE_4023
StrainRhodopseudomonas palustris BisA53
Repliconchromosome [GenBank: NC_008435] [Browse all T4SS(s) in this replicon]
Location [Strand]4507141..4507470 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ07JD5
KEGG IDrpe:RPE_4023
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.2e-24, Aligned region: 4..99
Protein Sequence: 109 a.a.     [Download]
>gi|115526018|ref|YP_782929.1| conjugal transfer protein TrbC [Rhodopseudomonas palustris BisA53]
MNQSLHQVRRHAFTAVTTGAFVLISGSAWAAGSNMPWEQPLNQILQSVEGPVAKILAVIIIIVTGLTLAF
GDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGVVV
 
Nucleotide Sequence: 330 bp     [Download]
>gi|115522030|ref|NC_008435.1|:c4507470-4507141 Rhodopseudomonas palustris BisA53 chromosome, complete genome
ATGAATCAGTCGCTTCATCAAGTTCGCCGCCACGCCTTCACCGCAGTCACGACTGGCGCTTTCGTGCTCA
TTTCGGGTTCGGCCTGGGCCGCCGGCTCGAACATGCCTTGGGAGCAGCCGCTCAATCAGATCCTGCAATC
CGTCGAAGGACCGGTCGCCAAAATCCTCGCGGTGATCATCATCATCGTCACCGGCTTGACGCTGGCGTTC
GGAGACACCTCGGGCGGATTCCGCAGACTGATCCAGATTGTGTTTGGCCTGTCGATTGCGTTCGCGGCGA
GCTCCTTCTTCCTGTCGTTCTTCTCATTCGGCGGCGGCGTGGTGGTGTGA
 Primer design