SecReT4
Protein ID: 115534827
T4SS name [ID]Tra_p [640]
Gene symbol-
Locus tagpRE25p25
StrainEnterococcus faecalis plasmid pRE25 (NC_008445)
Repliconplasmid pRE25 [GenBank: NC_008445] [Browse all T4SS(s) in this replicon]
Location [Strand]21625..21957 [+]
Producthypothetical protein
Component typeOrf2_p
UniProt IDQ79A50
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 110 a.a.     [Download]
>gi|115534827|ref|YP_783909.1| hypothetical protein pRE25p25 [Enterococcus faecalis]
MKKFIKDTKFKLGSAVVALGTLFITDPVFAATDPQAKLVQAGNTIKGVLTALIVVVGGIACAKIVIKYLP
SIDDPQEKNTMYKALGTALLVTALGGALVWLVPWAYGLLA
 
Nucleotide Sequence: 333 bp     [Download]
>gi|115534802|ref|NC_008445.1|:21625-21957 Enterococcus faecalis RE25 plasmid pRE25, complete sequence
ATGAAAAAATTTATCAAAGATACAAAGTTTAAGCTTGGAAGTGCGGTTGTTGCGTTGGGTACATTGTTTA
TTACTGATCCAGTGTTTGCAGCCACTGATCCACAAGCGAAATTAGTTCAAGCGGGTAACACTATAAAAGG
TGTTTTAACAGCCTTAATTGTTGTAGTTGGTGGGATTGCTTGTGCGAAGATTGTTATTAAATACTTGCCG
TCTATTGATGACCCACAAGAAAAAAATACCATGTATAAAGCCTTGGGAACAGCCTTGCTTGTTACGGCAT
TAGGTGGGGCGTTGGTTTGGTTAGTACCTTGGGCGTATGGCTTACTTGCTTAA
 Primer design