SecReT4
Protein ID: 115534828
T4SS name [ID]Tra_p [640]
Gene symbol-
Locus tagpRE25p26
StrainEnterococcus faecalis plasmid pRE25 (NC_008445)
Repliconplasmid pRE25 [GenBank: NC_008445] [Browse all T4SS(s) in this replicon]
Location [Strand]21976..22359 [+]
Producthypothetical protein
Component typeOrf3_p
UniProt IDQ79A49
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 127 a.a.     [Download]
>gi|115534828|ref|YP_783910.1| hypothetical protein pRE25p26 [Enterococcus faecalis]
MNSDQVKQALLDLLNADTEKGRTWFFPSNVSDRYTVILGLDLKQSAKAIGTALISVLLTILIFRSTAVFP
LIIYVIVGLVSFGGVWAFYTIKPITDRPNISISDFMKQRKDFSKRPKVYYKKPKERV
 
Nucleotide Sequence: 384 bp     [Download]
>gi|115534802|ref|NC_008445.1|:21976-22359 Enterococcus faecalis RE25 plasmid pRE25, complete sequence
ATGAATAGCGATCAAGTGAAACAAGCCCTATTAGATTTGTTAAATGCAGACACTGAAAAAGGGCGGACTT
GGTTTTTTCCGTCTAATGTATCTGATCGGTACACAGTCATTTTAGGGCTAGATTTAAAACAATCAGCAAA
AGCGATCGGTACGGCATTAATAAGCGTGTTATTGACAATTCTTATTTTCCGTAGCACAGCCGTTTTTCCT
TTAATTATCTATGTCATTGTTGGTTTGGTGTCATTTGGTGGTGTATGGGCGTTTTATACGATTAAACCAA
TTACAGACCGACCTAACATTTCTATATCTGATTTTATGAAGCAAAGAAAAGACTTTTCTAAAAGACCAAA
AGTCTATTACAAAAAGCCAAAAGAACGAGTGTAA
 Primer design