SecReT4
Protein ID: 115534830
T4SS name [ID]Tra_p [640]
Gene symbol-
Locus tagpRE25p28
StrainEnterococcus faecalis plasmid pRE25 (NC_008445)
Repliconplasmid pRE25 [GenBank: NC_008445] [Browse all T4SS(s) in this replicon]
Location [Strand]23016..24977 [+]
Producthypothetical protein
Component typeOrf5_p
UniProt IDQ79A47
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.4e-40, Aligned region: 244..586
Protein Sequence: 653 a.a.     [Download]
>gi|115534830|ref|YP_783912.1| hypothetical protein pRE25p28 [Enterococcus faecalis]
MEKIPKEKIVLIPEVDTDVVSDLAPFNFTVERDKLLIDDSYAVPYVITKYNNKPRGNWFNRIRKMSGDIT
ISHYYTKANGNSLNDYYNRTIKNKQAEIDRSHDPLTIIRLEREMKIAQTQLEQAVDENTSYLYLYTYVLI
KSKSEDKLKKLCEDFETRCIASGVKALIPYTMIDKAYWSSLPLQSNEVPEYTYTIANSISASSIFPFDDN
ELSVFTKNMIIEGINKDTENIVSIDYTNRKLVVNRNKFVFGLSGGGKTTYLTSDYLKKYAFSDNSTELRH
RIVLFDPEDEQTERVRSLGGEIINLSSMSDVRINPFQIYSRNTLDVDLKESLSDFEEDELVENIEIKHKD
YEMTDNDIDKEISKRMNILTPYFLMVDHSLTDSQLSIIKIEAKKCYTTLYEKKNLSKMENTDFPTFSDLE
NRLKALEETDPKRYKRIEDFIYSLEDFTIGSRTIFNGHTNIDLNNPLICFSLRDLQTEEGIRDLAYLNSF
SYLFEEITNNPQIVTSVYADEFHFLLKNKISADFFFQAYKRFRKYNADCTVSTQQIDDVLKAPDNIGKAI
IGNSFTKVFFGLDETEAQGISNELKLKLTKKELSFITSKRQGEALLFHGTKRAKIKVDLTQEEMRLLNPG
EYEDIYGVSPKKEINWLLRSKIQ
 
Nucleotide Sequence: 1962 bp     [Download]
>gi|115534802|ref|NC_008445.1|:23016-24977 Enterococcus faecalis RE25 plasmid pRE25, complete sequence
ATGGAGAAGATACCAAAAGAGAAAATTGTCTTGATACCCGAAGTTGATACGGACGTTGTATCTGATTTAG
CACCATTTAACTTTACAGTAGAACGTGACAAATTATTGATTGATGATTCATACGCAGTTCCCTATGTCAT
TACAAAATACAACAATAAGCCACGTGGGAATTGGTTTAATCGTATTCGTAAAATGAGTGGAGATATAACC
ATATCTCATTACTACACTAAAGCAAACGGTAACTCATTGAATGATTATTACAACAGAACCATTAAGAACA
AGCAAGCAGAGATCGATCGTTCGCATGATCCGTTGACGATTATCCGTTTAGAACGTGAAATGAAAATTGC
TCAAACGCAGTTAGAACAAGCCGTTGACGAAAACACTTCTTATCTTTACTTGTACACCTATGTTTTGATT
AAAAGTAAGTCAGAAGATAAATTAAAAAAATTGTGTGAAGATTTTGAAACACGTTGTATCGCAAGTGGAG
TAAAAGCGTTAATTCCATATACTATGATTGATAAGGCGTATTGGAGTTCATTACCGTTACAATCTAATGA
AGTACCTGAATACACCTATACAATCGCTAATTCAATCAGTGCAAGCAGTATTTTTCCTTTTGATGATAAT
GAATTAAGTGTATTTACTAAAAATATGATTATTGAGGGAATTAATAAAGATACTGAAAATATCGTTAGTA
TTGATTACACCAACAGAAAATTAGTAGTCAATCGTAATAAATTCGTTTTTGGTTTATCTGGTGGGGGAAA
GACCACTTACTTAACGTCAGACTATTTAAAAAAATATGCTTTTTCTGATAACTCAACAGAATTAAGGCAC
AGAATTGTTTTATTTGATCCCGAAGATGAACAAACAGAGCGTGTACGTTCTCTAGGGGGCGAAATAATCA
ATCTATCGTCTATGTCAGATGTTCGTATCAATCCATTTCAAATTTACTCACGCAATACGCTAGATGTTGA
TTTAAAAGAATCATTATCCGATTTTGAAGAGGACGAGCTTGTAGAAAATATTGAAATAAAGCATAAAGAT
TATGAAATGACTGACAATGATATTGATAAAGAAATCAGTAAACGAATGAATATTTTAACGCCTTATTTCC
TAATGGTGGATCATTCTTTGACTGATAGTCAATTATCCATTATTAAAATAGAAGCTAAAAAATGCTATAC
CACTTTATACGAGAAGAAAAACTTGTCAAAAATGGAAAACACCGATTTTCCAACATTTTCAGACTTAGAA
AATCGATTGAAAGCCTTAGAAGAAACTGATCCAAAAAGATACAAACGAATTGAAGATTTTATTTATTCAT
TAGAAGATTTTACAATCGGAAGTCGTACCATTTTTAACGGTCATACAAATATAGACTTAAACAATCCGTT
AATTTGCTTTTCTTTGCGAGATTTACAGACCGAAGAAGGGATCAGAGATTTAGCATACCTCAACAGCTTT
AGTTATCTATTTGAAGAAATAACCAACAATCCGCAAATTGTAACGTCTGTTTATGCAGATGAATTTCACT
TTTTATTGAAGAATAAAATTAGTGCTGACTTTTTCTTCCAAGCATATAAACGCTTTAGAAAATACAATGC
TGATTGTACCGTATCAACCCAACAGATTGATGATGTATTAAAAGCACCTGATAATATCGGTAAAGCAATT
ATTGGGAATAGCTTTACAAAAGTATTCTTCGGACTTGATGAAACGGAAGCACAAGGTATTTCAAATGAGT
TGAAACTTAAACTCACAAAAAAAGAATTATCGTTCATTACCTCAAAACGTCAAGGGGAAGCTTTGCTTTT
TCATGGTACAAAGCGAGCAAAGATAAAAGTAGATTTAACACAGGAAGAAATGCGTTTGCTTAACCCAGGC
GAATATGAAGATATTTACGGCGTTAGTCCGAAGAAAGAGATCAACTGGTTGTTAAGATCGAAAATTCAAT
AG
 Primer design