SecReT4
Protein ID: 115534832
T4SS name [ID]Tra_p [640]
Gene symbol-
Locus tagpRE25p30
StrainEnterococcus faecalis plasmid pRE25 (NC_008445)
Repliconplasmid pRE25 [GenBank: NC_008445] [Browse all T4SS(s) in this replicon]
Location [Strand]26365..27471 [+]
Producthypothetical protein
Component typeOrf7_p
UniProt IDQ9AL13
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 2.2e-57, Aligned region: 53..210
CHAP [PF05257], Evalue: 3.5e-30, Aligned region: 247..354
SLT [PF01464], Evalue: 2e-05, Aligned region: 83..158
Protein Sequence: 368 a.a.     [Download]
>gi|115534832|ref|YP_783914.1| hypothetical protein pRE25p30 [Enterococcus faecalis]
MGATAAKLLIRYRKPIAKAILGFFVFIIVIFLLIFNNDQTAPSGGLATENKNLSESVLRYKSTVEKYARQ
YDGMEYVPYILALMQIESGGNGGDPMQSSESLGLPPNTIKDPERSIQRGVEFFVENMKSAINRGSDIKTA
LQAYNYGGGFVDFVVKNGGTYSFELAKQFSINMSGGEKVPYVNALSTTMGYNYRYNYGNMFYVPKLLEYV
NESQASAEGVQNNSNNTGAVQVDVPSEYKNKLRYPRYDGHNYNTSGSYPFGQCTWYAFNRMAQIGKPVDD
FMGNGGEWGYKGKALGYKVTNKPKVGTAISFPPGSFGSDPVYGHVAFVEVVNADGTLLVSECNVVNPGSG
TIKLSSSASFYCKYCKLC
 
Nucleotide Sequence: 1107 bp     [Download]
>gi|115534802|ref|NC_008445.1|:26365-27471 Enterococcus faecalis RE25 plasmid pRE25, complete sequence
ATGGGAGCAACAGCTGCTAAACTGCTTATTCGTTATCGAAAACCGATAGCGAAAGCAATTTTAGGCTTTT
TCGTCTTTATCATTGTAATCTTCCTTCTTATTTTTAATAACGATCAAACCGCCCCTAGTGGCGGACTAGC
AACAGAAAACAAAAATTTAAGTGAATCTGTTTTGAGGTACAAAAGTACCGTTGAAAAGTACGCTAGACAA
TATGACGGTATGGAATATGTGCCTTATATCTTAGCCCTTATGCAAATTGAATCAGGCGGTAATGGTGGCG
ACCCTATGCAATCAAGCGAAAGTTTAGGACTGCCCCCGAACACTATTAAAGACCCCGAACGAAGCATACA
ACGAGGAGTAGAGTTTTTTGTAGAAAATATGAAAAGCGCTATAAACCGAGGATCAGATATAAAAACAGCT
CTTCAAGCGTATAATTATGGCGGTGGTTTTGTTGATTTTGTAGTGAAGAATGGCGGAACGTATTCTTTTG
AGTTGGCTAAACAATTTTCTATTAATATGTCAGGTGGCGAAAAGGTACCTTATGTAAATGCTTTATCTAC
TACAATGGGCTACAATTACCGCTATAACTACGGAAATATGTTCTATGTGCCAAAATTACTTGAATACGTT
AACGAAAGCCAGGCAAGCGCAGAGGGCGTTCAAAACAATTCTAATAATACTGGCGCTGTTCAAGTTGATG
TACCTAGTGAGTACAAAAATAAATTACGTTATCCAAGATATGATGGACACAACTATAATACCAGTGGAAG
TTATCCTTTTGGGCAATGTACTTGGTACGCTTTTAATCGTATGGCTCAAATAGGAAAACCAGTTGATGAT
TTTATGGGCAATGGTGGCGAATGGGGCTATAAAGGGAAAGCTTTAGGCTATAAAGTAACAAATAAGCCCA
AAGTAGGTACGGCAATTTCTTTCCCTCCAGGTTCTTTCGGTTCTGATCCAGTTTACGGACACGTTGCCTT
TGTAGAAGTCGTAAATGCAGACGGTACGCTTCTTGTATCAGAGTGTAATGTAGTAAACCCAGGAAGTGGA
ACAATCAAGTTATCGAGTAGTGCCAGCTTCTATTGCAAATATTGCAAGTTATGTTGA
 Primer design