SecReT4
Protein ID: 115534834
T4SS name [ID]Tra_p [640]
Gene symbol-
Locus tagpRE25p32
StrainEnterococcus faecalis plasmid pRE25 (NC_008445)
Repliconplasmid pRE25 [GenBank: NC_008445] [Browse all T4SS(s) in this replicon]
Location [Strand]28044..28475 [+]
Producthypothetical protein
Component typeOrf9_p
UniProt IDQ9AL11
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 143 a.a.     [Download]
>gi|115534834|ref|YP_783916.1| hypothetical protein pRE25p32 [Enterococcus faecalis]
MAKKKQEQVKLIVLVILYLLLLPVTLIVFKLLPFIIANDTNIELSTFVTTILKHPINTFLEIIQSNYMIP
FFIVQIIVLIILFVFLHPTKRQPFEVVGKTNPVHGSAYWGEESEINAPKNVHLIPEKSMKSILEKSMRRG
KND
 
Nucleotide Sequence: 432 bp     [Download]
>gi|115534802|ref|NC_008445.1|:28044-28475 Enterococcus faecalis RE25 plasmid pRE25, complete sequence
ATGGCGAAGAAGAAGCAAGAGCAAGTAAAATTGATTGTCTTAGTTATACTTTATCTTCTATTGTTGCCAG
TAACATTGATTGTGTTTAAATTATTACCTTTTATCATTGCGAATGATACAAATATTGAATTGAGTACCTT
TGTTACAACTATTTTAAAGCACCCGATCAATACTTTTTTAGAGATCATTCAATCTAATTACATGATTCCG
TTCTTCATTGTACAAATCATTGTTTTAATTATTTTATTTGTCTTTCTACACCCTACCAAACGCCAACCGT
TTGAGGTTGTCGGAAAAACAAACCCTGTTCATGGATCGGCTTATTGGGGGGAAGAATCAGAAATAAACGC
ACCAAAAAATGTTCATTTGATCCCTGAAAAATCAATGAAAAGCATATTAGAAAAATCAATGAGGAGGGGG
AAAAATGACTAG
 Primer design