SecReT4
Protein ID: 115534835
T4SS name [ID]Tra_p [640]
Gene symbol-
Locus tagpRE25p33
StrainEnterococcus faecalis plasmid pRE25 (NC_008445)
Repliconplasmid pRE25 [GenBank: NC_008445] [Browse all T4SS(s) in this replicon]
Location [Strand]28468..30123 [+]
Productputative TrsK protein
Component typeOrf10_p
UniProt IDQ9AL10
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.6e-95, Aligned region: 33..456
TraG-D_C [PF12696], Evalue: 5.3e-32, Aligned region: 289..416
TrwB_AAD_bind [PF10412], Evalue: 4.5e-16, Aligned region: 29..147
TrwB_AAD_bind [PF10412], Evalue: 4.5e-16, Aligned region: 266..418
Protein Sequence: 551 a.a.     [Download]
>gi|115534835|ref|YP_783917.1| putative TrsK protein [Enterococcus faecalis]
MTSLLAESDGLILGKFPSGKVVIQPEDSKISNRNIFVVGGPGSFKTQSYVLPNVVNNRSTSIVVTDPKGE
IYELTNEIKKAQGFKTVVINFKDFLLSSRYNPLLYIRKSNDTNKIANVIVSAKNDPKRKDFWFNAQLNLL
NTLIKYVYFEYEPSARTIEGILDFLEEFDPRYNEEGVSELDEQFERLPDGHEAKRSYYLGFRQAQSEARP
NIVISLLTTLQDFVDKEVSEFTSTNDFFFEELGTSKICLYVLISPLDRTWDGLVNLFFQQMFTELYFLGD
KHNAKLPVPLVMLLDEFVNLGYFPTYENFLATCRGYRISVSTILQSLPQGFELYGDKKFKAIIGNHAIKI
CLGGVEETTAEYFSRQVNDTTIKVYTGGTSESKTTAKTTNRSGSKSESYGYQKRRLITEGEVINLQQEEN
GRKSIVLIDGKPYMLRKTPQFELFGNLLKKHEISQQDYISSQTEFAKEYIEELEKQHKQRKVQLASAPIF
HEKKQEDDLNKKEINLPEQPIESEVTEEEEEKELLMSDILSSFDEGIEENTTNNDNSELPF
 
Nucleotide Sequence: 1656 bp     [Download]
>gi|115534802|ref|NC_008445.1|:28468-30123 Enterococcus faecalis RE25 plasmid pRE25, complete sequence
ATGACTAGTTTATTAGCAGAATCAGACGGTTTAATATTGGGGAAATTTCCAAGTGGAAAAGTTGTGATCC
AACCCGAAGATAGCAAAATAAGCAATCGAAATATTTTTGTAGTAGGTGGTCCAGGATCATTTAAAACACA
AAGTTATGTTTTGCCTAATGTTGTAAATAATCGCAGTACGTCAATTGTTGTAACCGATCCAAAAGGGGAA
ATTTACGAGTTAACCAATGAAATAAAAAAAGCCCAGGGCTTCAAAACGGTTGTCATAAATTTTAAAGATT
TTTTACTAAGTTCTAGGTACAATCCATTACTTTACATTCGCAAATCAAATGATACAAACAAGATTGCGAA
CGTCATAGTATCAGCAAAGAATGACCCCAAACGGAAAGATTTTTGGTTCAATGCACAATTAAACTTATTA
AATACGTTGATTAAATATGTTTATTTTGAATATGAACCAAGCGCAAGAACAATTGAGGGTATTTTAGACT
TTTTAGAAGAATTTGATCCACGCTATAACGAAGAAGGTGTATCAGAACTTGATGAACAATTTGAGCGTTT
GCCAGACGGACACGAAGCAAAACGCAGTTACTATTTAGGCTTCCGACAAGCACAAAGTGAAGCAAGACCA
AACATTGTTATTAGTCTATTGACGACTTTACAAGATTTTGTTGATAAAGAAGTATCAGAATTTACCAGTA
CAAACGATTTTTTCTTTGAGGAATTAGGAACGTCAAAAATTTGTTTATACGTGCTAATTTCCCCATTAGA
TCGAACTTGGGACGGCTTAGTGAATCTCTTTTTCCAACAAATGTTTACAGAGTTATATTTTTTAGGGGAT
AAGCACAACGCAAAATTGCCAGTACCTTTAGTTATGTTACTAGATGAATTTGTCAATTTGGGCTACTTTC
CAACATACGAGAATTTTCTTGCAACGTGTCGAGGGTATCGTATTTCAGTTAGTACCATATTGCAATCTTT
GCCCCAGGGCTTTGAACTTTACGGAGATAAGAAATTTAAAGCGATCATTGGGAATCATGCCATTAAAATA
TGTCTAGGTGGTGTAGAGGAAACGACCGCCGAATACTTTTCAAGACAAGTAAATGATACAACAATCAAAG
TATATACAGGCGGAACAAGTGAAAGTAAAACGACCGCAAAAACAACTAACCGAAGCGGAAGTAAGTCAGA
AAGCTACGGTTACCAAAAAAGGCGATTGATTACCGAAGGGGAAGTGATCAATTTACAACAAGAAGAAAAT
GGCAGAAAAAGTATAGTGTTGATTGACGGTAAACCTTACATGTTAAGAAAAACGCCACAATTTGAATTGT
TCGGAAATCTTCTTAAAAAGCATGAAATTTCACAGCAAGATTATATAAGCAGTCAAACAGAATTTGCCAA
AGAATACATTGAGGAGTTGGAAAAACAGCACAAACAACGAAAAGTGCAACTAGCAAGCGCCCCAATTTTT
CACGAGAAGAAACAAGAAGATGATTTGAATAAAAAAGAAATAAATCTACCTGAACAACCGATCGAATCAG
AAGTAACAGAAGAAGAGGAAGAAAAAGAACTATTAATGAGTGATATTCTAAGTAGTTTTGATGAAGGTAT
AGAGGAAAACACAACCAACAATGACAACAGCGAATTACCATTTTAA
 Primer design