SecReT4
Protein ID: 115534836
T4SS name [ID]Tra_p [640]
Gene symbol-
Locus tagpRE25p34
StrainEnterococcus faecalis plasmid pRE25 (NC_008445)
Repliconplasmid pRE25 [GenBank: NC_008445] [Browse all T4SS(s) in this replicon]
Location [Strand]30141..30605 [+]
Producthypothetical protein
Component typeOrf11_p
UniProt IDQ9AL09
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 154 a.a.     [Download]
>gi|115534836|ref|YP_783918.1| hypothetical protein pRE25p34 [Enterococcus faecalis]
MNGLKEFFGNIPMFQKQVEREIEEKGIEPSEGIKKMEFSRQVIRNLVIGVLVVGILAFVGISYFNNKNQP
PVTPTATTASKESNQSETSGEATENSSQAVQGSSDHLLKLSAKERADEATEAFESWYTSFSNGDVILEIN
KELLKEGSRRYKPD
 
Nucleotide Sequence: 465 bp     [Download]
>gi|115534802|ref|NC_008445.1|:30141-30605 Enterococcus faecalis RE25 plasmid pRE25, complete sequence
ATGAATGGATTGAAAGAATTTTTTGGGAATATCCCAATGTTTCAAAAACAAGTCGAACGAGAAATTGAAG
AAAAAGGAATTGAACCTAGTGAGGGTATTAAAAAAATGGAATTTAGCCGTCAAGTGATCCGTAACTTAGT
GATTGGCGTTTTAGTTGTCGGTATTCTTGCTTTTGTGGGCATTTCTTATTTTAACAATAAGAATCAACCA
CCAGTGACACCAACAGCCACCACCGCAAGCAAAGAAAGCAACCAGTCAGAAACAAGCGGAGAAGCCACAG
AAAACAGCTCACAAGCCGTTCAAGGTTCAAGCGACCATTTACTCAAATTAAGTGCGAAAGAACGAGCAGA
CGAAGCGACAGAAGCTTTTGAGAGTTGGTACACCTCTTTCTCTAATGGTGACGTGATTTTAGAAATCAAC
AAAGAATTATTGAAAGAAGGATCTAGGCGGTACAAGCCCGATTGA
 Primer design