SecReT4
Protein ID: 115534838
T4SS name [ID]Tra_p [640]
Gene symbol-
Locus tagpRE25p36
StrainEnterococcus faecalis plasmid pRE25 (NC_008445)
Repliconplasmid pRE25 [GenBank: NC_008445] [Browse all T4SS(s) in this replicon]
Location [Strand]31070..32002 [+]
Productputative TrsL protein
Component typeOrf12_p
UniProt IDQ9AL07
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 310 a.a.     [Download]
>gi|115534838|ref|YP_783920.1| putative TrsL protein [Enterococcus faecalis]
MDVIDQIKDTGSDILSSAGEAISNVFEGVKESVDSVLHPIDTLLGNWGSDLLEASMKIANKTTFDIPNIE
LISTITNVFVFATTTFAICIVLYKVIEAQIQASNGSGDALTANIVQKLFYSSIALATLPWAMNFFIKKIV
APIGEYVIQQVANDLNVETIGERLRNFLVSNFFNGGVSAVVLFVFVIFFAFSIAKYFVAICVFYADFLVL
TMLTPLVALSLLTDEQNYFQIWIKELLSEALTMLIKLILYLLMITLMIAEKYTLPNFMLMVGCGLLIIKT
PSALQNMWYSTKVSKGGGLGNLAMMAMFRK
 
Nucleotide Sequence: 933 bp     [Download]
>gi|115534802|ref|NC_008445.1|:31070-32002 Enterococcus faecalis RE25 plasmid pRE25, complete sequence
ATGGACGTAATAGACCAAATAAAAGATACAGGATCGGATATTTTAAGTTCTGCTGGTGAGGCTATCTCTA
ATGTCTTTGAGGGCGTAAAAGAGAGTGTGGATAGTGTATTGCACCCTATTGATACCTTGTTAGGGAATTG
GGGCAGTGACCTTTTAGAAGCCAGTATGAAAATTGCCAATAAGACGACTTTTGATATTCCCAATATCGAA
TTGATTAGTACCATTACCAATGTGTTTGTTTTTGCAACGACAACCTTTGCGATTTGTATTGTGTTGTATA
AGGTCATTGAAGCGCAAATACAAGCTTCTAATGGGAGTGGTGACGCATTGACCGCTAATATTGTTCAAAA
GCTGTTTTACTCGTCTATTGCCTTAGCAACGTTGCCCTGGGCAATGAACTTTTTTATCAAAAAGATTGTT
GCACCAATCGGGGAATATGTGATTCAACAAGTCGCTAATGATTTGAACGTGGAAACGATCGGCGAACGAT
TGCGTAATTTCTTAGTATCAAATTTCTTTAATGGTGGCGTTAGTGCCGTTGTTCTCTTTGTTTTTGTGAT
ATTCTTTGCCTTTTCCATTGCCAAGTATTTTGTAGCGATCTGTGTCTTTTATGCCGATTTCTTGGTACTG
ACTATGTTGACACCGTTAGTCGCCTTATCCCTTTTAACGGACGAGCAAAATTACTTTCAAATATGGATCA
AAGAACTGTTATCCGAAGCACTCACAATGCTTATTAAGCTTATTTTGTACTTACTCATGATTACACTCAT
GATTGCTGAAAAATACACGTTACCAAACTTTATGTTAATGGTTGGTTGTGGCTTGTTGATTATCAAAACA
CCGTCTGCCCTACAAAATATGTGGTATTCAACCAAAGTGTCAAAAGGTGGCGGACTTGGAAACTTAGCAA
TGATGGCTATGTTTAGAAAATAA
 Primer design