SecReT4
Protein ID: 115534839
T4SS name [ID]Tra_p [640]
Gene symbol-
Locus tagpRE25p37
StrainEnterococcus faecalis plasmid pRE25 (NC_008445)
Repliconplasmid pRE25 [GenBank: NC_008445] [Browse all T4SS(s) in this replicon]
Location [Strand]32293..32988 [+]
Producthypothetical protein
Component typeOrf13_p
UniProt IDQ9AL06
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 1.5e-08, Aligned region: 130..225
Protein Sequence: 231 a.a.     [Download]
>gi|115534839|ref|YP_783921.1| hypothetical protein pRE25p37 [Enterococcus faecalis]
MNEPTEPTLNTQELNRQELKTSNERQEIPQTEIPTETVNEPSVIKEISKKNQAKQTNSRKESLSESITKK
NVPKIHLFISILTLFIVLLIGISVIQQVQLQSVKKESELLKEQIERVKETDISQSKIDTFGRYFLTYYFS
QEKNKENYQSSLRSYVSEKVDIADWEALGKTLKSVNYYGSEQTKKGYSVEYLLNVTVEDRSKMQKITFEV
EPTKNGFLVTTQPKLTDFSFN
 
Nucleotide Sequence: 696 bp     [Download]
>gi|115534802|ref|NC_008445.1|:32293-32988 Enterococcus faecalis RE25 plasmid pRE25, complete sequence
TTGAATGAACCAACAGAACCAACGCTTAATACGCAAGAATTAAACCGTCAGGAGTTAAAAACGAGTAATG
AACGCCAAGAAATACCGCAGACAGAAATTCCAACTGAAACAGTAAATGAACCTAGTGTTATTAAGGAAAT
ATCGAAAAAGAACCAAGCAAAACAAACGAATAGCAGAAAAGAATCACTATCAGAATCCATAACCAAGAAA
AATGTTCCCAAAATTCATTTGTTCATATCTATTTTGACCCTTTTTATTGTATTATTGATAGGAATAAGTG
TTATTCAACAAGTACAACTTCAATCAGTCAAAAAAGAGAGCGAATTATTGAAAGAACAAATTGAGCGTGT
CAAAGAAACGGATATTTCTCAATCGAAAATAGATACTTTTGGTAGATACTTTTTAACTTATTATTTTTCA
CAAGAAAAAAATAAAGAAAATTATCAATCTAGTTTAAGAAGTTATGTATCAGAAAAAGTAGATATAGCTG
ATTGGGAAGCGTTAGGGAAAACTCTTAAAAGTGTTAATTATTACGGTAGCGAACAAACAAAAAAAGGGTA
TAGTGTTGAATACCTTTTAAATGTTACGGTAGAGGATCGTAGTAAAATGCAAAAAATCACTTTTGAGGTT
GAACCAACTAAAAACGGCTTTCTTGTGACAACTCAACCAAAACTTACAGACTTCTCTTTTAACTGA
 Primer design