SecReT4
Protein ID: 115534841
T4SS name [ID]Tra_p [640]
Gene symbol-
Locus tagpRE25p39
StrainEnterococcus faecalis plasmid pRE25 (NC_008445)
Repliconplasmid pRE25 [GenBank: NC_008445] [Browse all T4SS(s) in this replicon]
Location [Strand]33445..34233 [+]
Producthypothetical protein
Component typeOrf15_p
UniProt IDQ9AL05
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Gram_pos_anchor [PF00746], Evalue: 3.2e-10, Aligned region: 226..261
Protein Sequence: 262 a.a.     [Download]
>gi|115534841|ref|YP_783923.1| hypothetical protein pRE25p39 [Enterococcus faecalis]
MKKLALLTLFSTTLLVSAPIVSFADETASSSDINILADDDPVVPVEPTDPTTPVDPVDPVDPVDPVDPVD
PVDPVDPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPSKPTEPTEPSKP
TEPTEPTEPSKPTEPSKPTEPTVPNKPVDTNPIENPVNTDTGVVIVAVEDSKPIIQLADGTTKKVEAKEI
GADVQKDGTVTVKGSDGKMKVLPKTGETANIALSVLGSLMVLGSGIIFKKRI
 
Nucleotide Sequence: 789 bp     [Download]
>gi|115534802|ref|NC_008445.1|:33445-34233 Enterococcus faecalis RE25 plasmid pRE25, complete sequence
ATGAAAAAACTTGCCCTCTTAACACTATTCAGCACTACTTTATTAGTATCAGCACCGATTGTCAGTTTTG
CAGACGAAACCGCAAGTAGCAGTGATATTAATATCTTAGCCGATGATGATCCAGTCGTTCCAGTAGAACC
GACAGACCCGACTACTCCAGTTGATCCAGTTGATCCAGTTGATCCAGTTGATCCAGTTGATCCGGTTGAT
CCAGTTGATCCAGTTGATCCAACAGAGCCAACAGAGCCAACAGAGCCAACAGAGCCAACAGAGCCAACAG
AGCCAACGGAGCCAACAGAGCCAACAGAGCCAACAGAGCCAACAGAGCCAACAGAGCCAACGGAACCAAC
AGAACCAACGGAGCCAACGGAACCAACGGAACCAAGCAAGCCAACAGAGCCAACGGAACCAAGTAAGCCA
ACGGAACCAACAGAGCCAACGGAACCAAGCAAGCCGACAGAACCAAGTAAACCAACAGAGCCAACAGTAC
CAAACAAACCAGTAGACACAAACCCAATTGAAAACCCAGTTAATACAGATACAGGCGTTGTGATTGTTGC
GGTTGAAGATAGTAAACCAATCATTCAATTAGCAGACGGAACAACAAAAAAAGTTGAAGCTAAAGAAATT
GGAGCAGACGTTCAAAAAGACGGAACAGTAACGGTTAAAGGTTCAGACGGAAAAATGAAGGTTTTACCAA
AAACAGGTGAAACAGCAAATATTGCACTGTCTGTCCTAGGTTCATTAATGGTATTAGGATCAGGAATCAT
TTTTAAAAAGAGAATTTAA
 Primer design