SecReT4
Protein ID: 116006754
T4SS name [ID]Trb [77]
Gene symboltrbB
Locus tagST520_p30
StrainBordetella pertussis plasmid pBP136 (NC_008459)
Repliconplasmid pBP136 [GenBank: NC_008459] [Browse all T4SS(s) in this replicon]
Location [Strand]11926..12888 [+]
ProductTrbB
Component typeTrbB
UniProt IDQ08L01
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6e-86, Aligned region: 27..295
FtsK_SpoIIIE [PF01580], Evalue: 8.6e-08, Aligned region: 139..195
AAA_10 [PF12846], Evalue: 1e-06, Aligned region: 150..198
AAA_19 [PF13245], Evalue: 1.2e-05, Aligned region: 141..189
AAA_16 [PF13191], Evalue: 1.8e-05, Aligned region: 140..176
AAA_29 [PF13555], Evalue: 4.4e-05, Aligned region: 148..171
DUF87 [PF01935], Evalue: 4.9e-05, Aligned region: 150..190
Protein Sequence: 320 a.a.     [Download]
>gi|116006754|ref|YP_787938.1| TrbB [Bordetella pertussis]
MTDQKPEHNSIKERAKKKLERDMGPELLAALNDPKTVEIMLNADGKLWLERLGEPMTCIGTLRVAQAQAI
IETIAGYHGKEVTRSKPILEGELPLDGSRFAGQLPPVVPAPTFAIRKKAVAIFTLDQYVERGIMTAPQRE
ALIAAVRAHRNILVIGGTGSGKTTLVNAIINEMVIQDPTERVFIIEDTGEIQCAAENYVQYHTTIDVNMT
ALLKTTLRMRPDRILVGEVRGPEALDLLMAWNTGHEGGAATLHANNAKAGLDRLAMLISMHPDSPKPIEP
LIGEAVHVVVHIARVEGSRRIQEILEVSGFANGQYITKTL
 
Nucleotide Sequence: 963 bp     [Download]
>gi|116006736|ref|NC_008459.1|:11926-12888 Bordetella pertussis plasmid pBP136 DNA, complete sequence
ATGACCGACCAGAAACCAGAACACAACAGCATCAAGGAACGGGCGAAGAAGAAGCTCGAACGCGACATGG
GGCCGGAGCTGCTGGCCGCCCTCAATGATCCCAAGACCGTTGAAATCATGCTCAACGCGGACGGCAAGCT
CTGGCTCGAACGCCTGGGCGAGCCGATGACGTGCATCGGCACGCTGCGCGTCGCGCAGGCGCAAGCCATC
ATCGAAACCATCGCGGGCTACCACGGCAAGGAAGTCACGCGCTCCAAGCCGATCCTGGAAGGCGAGCTGC
CCCTGGATGGCAGCCGCTTCGCCGGCCAGCTCCCGCCGGTTGTGCCCGCACCCACCTTCGCCATTCGGAA
GAAGGCTGTCGCCATCTTCACGCTCGATCAGTACGTCGAACGCGGAATCATGACCGCGCCGCAGCGCGAA
GCGTTGATTGCAGCGGTGCGCGCGCACCGGAACATCCTCGTGATCGGCGGCACCGGCTCGGGCAAGACCA
CGCTGGTGAACGCAATCATCAACGAGATGGTGATTCAAGACCCGACCGAGCGGGTTTTCATCATCGAGGA
CACCGGCGAAATCCAGTGCGCCGCCGAGAACTACGTCCAGTACCACACCACCATCGACGTGAACATGACG
GCGCTGCTGAAAACCACCCTCCGCATGCGCCCCGACCGAATCCTGGTCGGCGAGGTGCGCGGCCCCGAAG
CCCTTGATCTGTTGATGGCCTGGAACACCGGGCACGAAGGAGGTGCTGCAACCCTGCACGCAAACAACGC
CAAAGCTGGATTGGATCGGCTCGCCATGCTCATCAGCATGCACCCCGATTCCCCGAAACCCATTGAACCG
CTTATCGGCGAGGCGGTTCACGTGGTTGTTCATATCGCCCGCGTCGAAGGCTCGCGGCGCATCCAGGAAA
TCTTGGAGGTTTCCGGGTTCGCCAACGGCCAGTACATCACCAAAACCCTCTGA
 Primer design