SecReT4
Protein ID: 116006756
T4SS name [ID]Trb [77]
Gene symboltrbD
Locus tagST520_p28
StrainBordetella pertussis plasmid pBP136 (NC_008459)
Repliconplasmid pBP136 [GenBank: NC_008459] [Browse all T4SS(s) in this replicon]
Location [Strand]13372..13683 [+]
ProductTrbD
Component typeTrbD
UniProt IDQ08KZ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.6e-26, Aligned region: 1..87
Protein Sequence: 103 a.a.     [Download]
>gi|116006756|ref|YP_787940.1| TrbD [Bordetella pertussis]
MALRAIPIRRAGNRENLFMGGDRELVMFSGLLAGALIFSAQEVRATVFGIALWFGALFALRLMAKADPKL
RHVYLRHRRYKPYYPARSTPFRDNTPSQGKQYK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|116006736|ref|NC_008459.1|:13372-13683 Bordetella pertussis plasmid pBP136 DNA, complete sequence
ATGGCTCTGCGCGCGATCCCCATCCGTAGGGCCGGCAACCGAGAAAACCTGTTCATGGGCGGGGATCGTG
AGCTGGTGATGTTCTCGGGCCTGCTGGCCGGCGCGCTGATTTTCAGCGCCCAAGAAGTGAGGGCAACGGT
GTTCGGCATCGCCTTGTGGTTCGGCGCACTCTTCGCGCTGCGCCTCATGGCGAAGGCCGATCCGAAGCTG
CGACACGTGTACCTGCGGCACCGCCGGTACAAGCCGTACTACCCGGCTCGCAGCACGCCCTTCCGTGACA
ACACGCCGAGTCAAGGGAAGCAATACAAATGA
 Primer design