SecReT4
Protein ID: 116006757
T4SS name [ID]Trb [77]
Gene symboltrbE
Locus tagST520_p27
StrainBordetella pertussis plasmid pBP136 (NC_008459)
Repliconplasmid pBP136 [GenBank: NC_008459] [Browse all T4SS(s) in this replicon]
Location [Strand]13680..16238 [+]
ProductTrbE
Component typeTrbE
UniProt IDQ08KZ8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.8e-54, Aligned region: 218..431
AAA_10 [PF12846], Evalue: 1.3e-29, Aligned region: 489..770
Protein Sequence: 852 a.a.     [Download]
>gi|116006757|ref|YP_787941.1| TrbE [Bordetella pertussis]
MIEAITIAIAVLGAVLLLILFARIRAVDAELKLKKHRAKDAGLADLLNYAAVVDDGVIVGKNGSFMAAWL
YKGDDNASSTEEQREMVSFRINQALAGLGNGWMVHVDAVRRPAPNYSERGVSSFPDSVCFAIDEERRRLF
EGLGAMFEGYFVLTVTWFPPVLAQRKFVELMFDDDAVAPDHTARTTGLIAQFKREITSLESRLSSAVKMT
RLRGQKVVSEEGREVTHDDFLSWLQFCVTGLHHPVMLPSNPMYLDAVIGGQELWGGVVPKIGRKFIQVVA
IEGFPLESTPGILSALAELPCEYRWSSRFIFMDQHESLKHLDKFRKKWRQKVRGFFDQVFNTNTGPINQD
AASMVADAEQAIAEVSSGLVAAGYYTSVVVLMDENRDRLAAAALQVEKAINRLAFTARIETINTLDAYLG
SLPGHGVENVRRPLINTMNLADLLPTSSIWTGSATAPCPMYPPLSPALMHCVTVGATPFRLNLHVRDLGH
TFMFGPTGAGKSTHLGIIAAQLRRYAGMSIYAFDKGMSMYPLAAGIRAATKGKSGLHFTVAADDDRLAFC
PLQFLETKGDRAWAMEWIDTILALNGVNTTPAQRNEIGNAIMSMHASGARTLSEFSVTIQDEAIREAIKQ
YTVDGSMGHLLDAEEDSLSLSDFTVFEIEELMNLGEKFALPVLLYLFRRIERALKGQPSAIILDEAWLML
GHPAFRAKIREWLKVLRKANCLVLMATQSLSDAANSGILDVIVESTATKIFLPNVYARDEDTSALYRRMG
LNARQIEILATAIPKRQYYYVSENGRRLYDLALGPMALAFVGASDKESVATIKSLEAKFGHEWVHEWLAG
RGLNLNDYLEAA
 
Nucleotide Sequence: 2559 bp     [Download]
>gi|116006736|ref|NC_008459.1|:13680-16238 Bordetella pertussis plasmid pBP136 DNA, complete sequence
ATGATCGAAGCAATCACGATTGCCATTGCTGTGCTCGGTGCGGTTCTGTTGCTCATCCTCTTTGCCCGCA
TCCGGGCTGTCGATGCCGAGCTGAAGCTCAAGAAGCATCGCGCCAAGGATGCCGGCCTGGCCGATCTGCT
CAATTACGCCGCCGTGGTCGATGACGGCGTGATCGTGGGCAAGAACGGCTCCTTTATGGCCGCCTGGCTG
TACAAGGGGGATGACAACGCCAGCAGCACCGAGGAACAGCGGGAAATGGTGTCGTTCCGCATCAACCAGG
CCCTGGCGGGCCTGGGGAACGGCTGGATGGTGCATGTCGATGCTGTGCGTCGGCCTGCGCCGAACTACTC
GGAGCGGGGCGTGTCATCGTTCCCCGACTCCGTTTGCTTCGCCATTGACGAGGAACGCCGGCGCTTGTTC
GAGGGCCTGGGCGCGATGTTCGAGGGCTACTTTGTCCTGACCGTCACGTGGTTCCCGCCAGTGCTGGCCC
AGCGCAAGTTTGTCGAACTCATGTTCGATGACGATGCGGTGGCTCCCGACCATACGGCGCGCACTACGGG
CCTGATTGCGCAGTTCAAGCGCGAGATCACCAGCCTGGAATCGCGCCTGTCCTCGGCGGTCAAGATGACG
CGCCTGCGCGGCCAAAAAGTCGTGTCGGAAGAGGGCAGGGAAGTCACGCACGATGACTTCCTGAGCTGGT
TGCAGTTCTGCGTGACGGGCCTCCATCACCCGGTCATGCTGCCCAGCAATCCGATGTACCTGGACGCGGT
TATCGGTGGGCAAGAGCTGTGGGGTGGGGTAGTGCCCAAAATCGGCCGCAAGTTCATTCAGGTGGTCGCC
ATCGAAGGTTTCCCCTTGGAGTCAACCCCTGGGATTCTCTCGGCCCTAGCCGAACTGCCTTGTGAATATC
GCTGGTCGAGCCGGTTCATCTTCATGGATCAGCACGAGTCTTTGAAGCACCTGGACAAGTTCCGCAAGAA
GTGGCGGCAGAAGGTTCGCGGCTTTTTCGATCAGGTTTTCAACACCAACACCGGCCCGATCAACCAGGAT
GCGGCTTCGATGGTGGCCGACGCGGAGCAAGCCATTGCTGAGGTCAGCAGCGGCCTGGTTGCAGCCGGCT
ATTACACCAGCGTGGTCGTGCTGATGGATGAGAATCGAGATCGCCTTGCGGCGGCTGCTCTCCAGGTCGA
GAAGGCAATCAACCGCTTGGCCTTCACGGCTCGCATCGAGACGATCAACACGCTAGATGCCTACCTGGGA
AGTCTGCCGGGCCACGGCGTTGAGAACGTGCGCCGGCCGCTCATCAACACGATGAACCTGGCCGACCTGC
TGCCGACAAGCTCGATCTGGACGGGCAGCGCCACGGCTCCGTGCCCGATGTACCCGCCGCTGTCGCCGGC
GCTCATGCACTGCGTGACGGTGGGCGCTACTCCGTTCCGCCTGAACCTGCACGTGCGCGACCTGGGCCAC
ACGTTCATGTTCGGCCCGACCGGCGCAGGCAAATCGACGCACCTGGGCATCATCGCCGCGCAGCTCCGTC
GCTACGCCGGCATGTCGATCTACGCCTTCGACAAGGGCATGTCGATGTACCCGCTCGCGGCCGGCATCCG
CGCGGCCACGAAGGGCAAGAGCGGCCTGCATTTCACGGTGGCCGCCGACGATGACCGCCTGGCGTTCTGC
CCGCTCCAGTTCCTCGAAACGAAGGGGGATAGGGCCTGGGCGATGGAGTGGATCGACACCATCCTGGCGT
TGAACGGCGTCAACACCACGCCGGCGCAGCGCAACGAGATCGGCAACGCGATCATGAGCATGCACGCCAG
CGGCGCGCGCACGCTCTCCGAGTTCTCGGTGACGATTCAGGACGAGGCGATCCGCGAGGCCATCAAGCAG
TACACGGTGGACGGCTCGATGGGCCACCTGCTCGACGCCGAAGAGGACAGCCTGTCGCTGTCCGACTTCA
CGGTGTTCGAGATCGAAGAGCTGATGAACCTGGGCGAGAAGTTCGCGCTGCCGGTGCTGCTCTACCTGTT
CCGCCGCATCGAGCGCGCACTGAAAGGCCAGCCCTCCGCCATCATCCTGGACGAAGCCTGGTTGATGCTG
GGCCACCCCGCGTTCCGCGCCAAGATCAGGGAATGGCTCAAGGTGCTGCGCAAGGCCAACTGCCTTGTGC
TGATGGCGACGCAAAGCCTCTCCGACGCGGCCAACTCGGGCATCTTGGACGTGATCGTGGAATCGACCGC
GACCAAGATTTTCCTGCCCAACGTCTACGCCAGGGATGAGGACACATCGGCGCTCTATCGCCGTATGGGC
CTCAACGCGCGTCAGATCGAAATCCTGGCGACCGCCATTCCGAAACGTCAGTACTACTACGTCTCGGAGA
ACGGCCGCCGTCTCTATGACCTTGCCCTGGGGCCGATGGCCCTGGCCTTCGTCGGTGCGTCCGACAAGGA
ATCGGTCGCCACCATCAAGAGCCTCGAAGCCAAGTTCGGCCACGAATGGGTGCATGAGTGGCTGGCCGGC
CGTGGGCTGAATCTCAACGACTACCTGGAGGCCGCATGA
 Primer design